KEGG   Tribolium castaneum (red flour beetle): 100142274Help
Entry
100142274         CDS       T01046                                 

Definition
(RefSeq) 4-aminobutyrate aminotransferase, mitochondrial-like
  KO
K13524  
4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Module
GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:tca00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    100142274
   00650 Butanoate metabolism
    100142274
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    100142274
   00280 Valine, leucine and isoleucine degradation
    100142274
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100142274
Enzymes [BR:tca01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     100142274
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     100142274
Amino acid related enzymes [BR:tca01007]
 Aminotransferase (transaminase)
  Class III
   100142274
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
LG9
AA seq 494 aa AA seqDB search
MWSRALRSNLKLSKSEACIFFKNKIRGASTCVEGEPEGPVVKTDIPGPKSKQLLQELGSL
QQVGTIQLFANYDKSIGNYLVDADDNILLDTYTQISSLPLGYNHPELLKVFNDQHNMKCL
INRPALGVFPGEDWPKRLNGILSEISPKLPNITTMMCGSCSNENAFKNIFIAYQRKKRGD
VDFSEEEKSSCVLNQPPGAPKLSIMSFKNAFHGRTLGSLSTTHSKYIHKIDIPSFDWPIA
TFPQYKYPLEDNQRENEEQDKKCLSEVEELFEKYEKKGIPVAGIIVEPIQSEGGDNEASP
QFFQQLQKIAKKNNAYLLIDEVQTGGGCTGKFWCHEHFNLETPPDIVTFSKKMQLGGYFH
TAEMTPRQPARVFNTWMGDPGKLIILQTVLRVIKEQKLLDNVLHTGTLLKIGLLELEKEF
CYLLNSTRGRGTFLAVNATDSKLRDEILTKLKAKGIQSGGCGSNSVRLRPALIFQEHHAN
IFLDKFRQVLKEIN
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgtggtccagagcgttgaggagtaatttaaaattgagtaagtctgaggcttgcattttt
ttcaaaaataaaatacgaggagcctcgacttgcgtggagggagaaccggaagggccggtt
gtcaaaactgacattccggggccaaaatcaaagcaacttttgcaggaactgggatcacta
cagcaagttggaacaatacaattgtttgccaattatgataaatcaatcgggaattactta
gtggacgctgatgacaatatcctcctggatacgtacacccaaatttcgtccctccctttg
ggctacaaccacccggaattgctgaaagtgttcaatgaccaacacaacatgaaatgtttg
attaacagaccggcccttggtgttttcccgggggaagattggcccaaacgcctgaatgga
attcttagtgagatttcgccaaaattgccaaacattacaacaatgatgtgcggctcatgt
tcaaacgaaaacgccttcaaaaacatttttatcgcttatcagcgcaaaaaacgaggtgac
gttgacttcagcgaggaggaaaaatcctcgtgtgtcctaaaccagcccccaggtgccccc
aaactctcaataatgtcgttcaaaaacgccttccacggccgcactttgggctccctctcc
accacccattcgaaatatattcacaaaatcgatattccgtcgttcgattggcccattgcc
acgttcccccagtacaaataccctttagaagacaaccagcgcgaaaacgaagaacaagac
aagaagtgcttgtccgaagttgaagagttgttcgaaaagtacgaaaagaagggcattccc
gttgcgggaatcatcgtggagcccatccagtctgaagggggcgacaacgaggcttcgccc
caattttttcaacagttgcaaaaaatcgcaaagaagaataacgcctacttgttgattgac
gaggtccaaactggcgggggctgcactgggaaattctggtgccacgaacattttaaccta
gagacgccccccgatattgtgactttcagcaagaaaatgcagttggggggctatttccac
acggcggaaatgacgccgagacaaccggcgcgcgttttcaacacctggatgggtgacccc
gggaaactgataattttgcaaacggtcctgagggttattaaggagcaaaaacttctagat
aacgtgctgcacacgggcacactgctgaaaatcgggcttctggagttggagaaagagttt
tgttacttgctgaattcaacaagggggcgaggaacgtttttggcagtgaatgcgacggat
tcaaagttgagggatgagatcttgacgaagttgaaagccaagggtatccaatctggtggc
tgtggcagcaacagtgttcgattgagaccagctttaattttccaagagcatcacgcaaat
atatttttggataaatttagacaagtgttgaaggaaattaactaa

DBGET integrated database retrieval system