KEGG   Tribolium castaneum (red flour beetle): 658395Help
Entry
658395            CDS       T01046                                 

Definition
(RefSeq) alpha-aminoadipic semialdehyde dehydrogenase
  KO
K14085  aldehyde dehydrogenase family 7 member A1 [EC:1.2.1.31 1.2.1.8 1.2.1.3]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
tca00010  Glycolysis / Gluconeogenesis
tca00053  Ascorbate and aldarate metabolism
tca00071  Fatty acid degradation
tca00260  Glycine, serine and threonine metabolism
tca00280  Valine, leucine and isoleucine degradation
tca00310  Lysine degradation
tca00330  Arginine and proline metabolism
tca00340  Histidine metabolism
tca00380  Tryptophan metabolism
tca00410  beta-Alanine metabolism
tca00561  Glycerolipid metabolism
tca00620  Pyruvate metabolism
tca01100  Metabolic pathways
Module
tca_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
tca_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:tca00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    658395
   00053 Ascorbate and aldarate metabolism
    658395
   00620 Pyruvate metabolism
    658395
  Lipid metabolism
   00071 Fatty acid degradation
    658395
   00561 Glycerolipid metabolism
    658395
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    658395
   00280 Valine, leucine and isoleucine degradation
    658395
   00310 Lysine degradation
    658395
   00330 Arginine and proline metabolism
    658395
   00340 Histidine metabolism
    658395
   00380 Tryptophan metabolism
    658395
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    658395
Enzymes [BR:tca01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     658395
    1.2.1.8  betaine-aldehyde dehydrogenase
     658395
    1.2.1.31  L-aminoadipate-semialdehyde dehydrogenase
     658395
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 658395
NCBI-ProteinID: XP_969882
BEETLEBASE: TC005191
LinkDB All DBs
Position
Un
AA seq 541 aa AA seqDB search
MTPLTGRLAPVQLFSLCKKFASVHRMSTSAQYLINDPKYSFLKDLGLKASNLGVYDGTWR
GSGSLVQSICPSNGKVIAEVRQGTAEDYTSCVTASQSAWSTWADLPAPQRGEIVRQIGDA
LRAKLHPLGQLVSLEMGKILPEGIGEVQEYVDICDYAVGLSRTLAGAIYPSERPGHVLME
KWNPLGVVGVISAFNFPIAVYGWNSAIAMVCGDTVLWKGAETTPLVSVATTRIVADVLER
NHLPGAVAALCCGGADVGKAMAADERIKLLSFTGSSQVGHQVGVEVQKRFGRHLLELGGN
NALIVAEDADLNMVVQATLFACVGTAGQRCTTTRRLILHKNVYDEVLQRLKKAYEQVLHR
IGDALDEKTLIGPLHSQTSLQNYENRIAEIKKQGGTIEFGGKRIEGPGFFVQPTIVTGLK
HDNPLVHSECFAPIVYILKTESVDEAISWNNEVPQGLSSSIFTQSIGNIFKWIGPKGSDC
GIVNVNIPTSGAEIGGAFGGEKHTGGGRESGSDAWKQYMRRSTITINHSKELPLAQGIKF
E
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgacaccactcacaggacgactagcaccagtccagttattttccctgtgcaaaaaattt
gctagtgtccacaggatgtccacttcggcccaatacctcataaacgaccccaaatactca
tttctgaaggacttgggcttgaaggcctccaacttgggcgtctacgacggcacgtggagg
ggctcaggctcgttagtccagtcgatttgtcccagcaatggtaaagtgatcgccgaagtc
cgccaaggcacagccgaggactacacctcttgcgtcacagcctcccaatcagcctggagc
acgtgggccgacctcccagccccccagcgcggggaaattgtgcgccagatcggggacgcc
ctccgggccaaactccaccccctggggcagctcgtttccctcgaaatgggcaaaatcctc
cccgagggaatcggggaagtccaggagtacgtggacatctgtgactacgccgtcggtctc
tcgcgcactctggcaggcgccatctacccctcggagcgcccaggccacgtgctgatggaa
aagtggaaccctctgggtgtcgtgggggtgatttcggccttcaatttccccatcgctgtc
tatggctggaacagcgccatcgccatggtctgcggggacacggtgctgtggaagggggcg
gaaaccacccccttggtgtcggtcgccaccacgaggatcgtggccgacgtcctcgagcgc
aaccacctcccgggggccgtcgcggcgctgtgctgtggaggcgccgatgtgggcaaggct
atggccgccgacgagaggattaagctgttgtcgttcactgggagttcgcaggttgggcac
caagtcggggtggaggtgcagaagaggttcgggagacatttgctggagttggggggaaat
aatgcacttattgttgccgaagacgctgatttgaatatggtggtgcaagcgacgttgttt
gcttgtgtggggacggcggggcaaaggtgtaccaccacgaggaggcttattttgcacaaa
aatgtctatgacgaggttctccaaaggctgaaaaaagcctacgagcaagtcttgcatcga
attggggacgcactggatgaaaaaaccttaatagggccattacacagtcaaacctcccta
caaaactatgaaaacagaatagctgagattaaaaagcaaggcgggacgattgaattcggg
ggcaaacgaatcgaaggtcctggctttttcgtacaaccaaccattgtcacaggcctcaaa
cacgataatcccctagttcacagcgaatgtttcgcgcctattgtctatattttgaaaacg
gaaagtgtagatgaagccatttcgtggaataatgaagttccccaaggcctatcgtcaagt
attttcacacaaagcattggaaatattttcaagtggattggacccaaaggttcggactgt
ggcattgtgaacgtgaatattcccacttcgggggctgaaattgggggggccttcggtggg
gaaaaacacactggtggggggagggaatctggaagtgatgcctggaaacagtacatgagg
aggtccactatcacgatcaatcattccaaggaattgcccttagcacaaggaattaaattt
gaataa

DBGET integrated database retrieval system