KEGG   Theobroma cacao (cacao): 18588505Help
Entry
18588505          CDS       T02994                                 

Definition
(RefSeq) hexokinase-1
  KO
K00844  
hexokinase [EC:2.7.1.1]
Organism
tcc  Theobroma cacao (cacao)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:tcc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    18588505
   00051 Fructose and mannose metabolism
    18588505
   00052 Galactose metabolism
    18588505
   00500 Starch and sucrose metabolism
    18588505
   00520 Amino sugar and nucleotide sugar metabolism
    18588505
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    18588505
Enzymes [BR:tcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     18588505
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
9
AA seq 498 aa AA seqDB search
MGKVAVGAAVVCAAAVCAAAALVVRHRIKSSGKWARTLAILKEFEEKCGTPISKLKQVAD
AMTVEMHAGLASEGGSKLKMIISYVDNLPTGDEKGLFYALDLGGTNFRVLRVQLGGKESR
VVKQEFEEVSIPPHLMTGSSDALFDYIASALAKFVATESEGLHVSPGRQRELGFTFSFPV
RQTSISSGTLIKWTKGFSIDDTVGQDVVGELTKAMERVGLDMRVAALVNDTIGTLAGGRY
NNPDVVAAVILGTGTNAAYVERAHAIPKWHGLLPKSGDMVINMEWGNFRSSHLPLTEYDQ
ELDADSLNPGEQIFEKMISGMYLGEIVRRVLYKMAEEAEFFGDTVPPKLKIPFILRTPHM
SAMHHDTSPDLKVVATKLKDILEISNTSLKMRKVIVELCDIVATRGARLSAAGIVGILKK
LGRDIVKDGEKLKSVVALDGGLYEHYTKFRTCMENTLTELLGDEVSDNIVIEHSNDGSGI
GATLLAACHSQYIEVEES
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atggggaaggtggcggtgggagcggctgtggtttgcgctgcggcggtgtgtgctgcggcg
gcactggtggtgcgtcacaggatcaagagttcggggaagtgggcccgtacgctggctatc
ctgaaagagttcgaggaaaaatgtgggaccccaatttcgaagctgaagcaggtggcggat
gctatgaccgttgagatgcacgcggggctcgcatcagagggtggcagcaagctcaagatg
atcatcagctacgtagataatctccccactggtgacgagaaagggttgttttatgccctt
gaccttggtggcacaaattttcgtgtcctacgtgtacagttgggtggtaaagaaagccgt
gttgttaagcaggaatttgaggaagtttcaattcctccgcatttgatgaccggatcttct
gatgcattatttgattatattgcttcagctcttgcaaaatttgttgctacagaaagtgaa
ggtttacatgtttcacctggtagacaaagggagctgggattcactttctcgtttcctgtt
aggcaaacatcaatatcatcagggactcttataaaatggacaaagggcttctcgatagat
gatacagttggacaagatgttgtgggtgagttgaccaaagccatggaaagggttggcctt
gacatgcgtgtggcagctttggttaatgatacaattgggacattggctggtggtagatac
aacaacccagatgttgttgctgctgtgatattgggtacaggcacaaatgcagcttatgta
gagcgtgcccacgcaattcccaaatggcatggtcttctacctaaatcaggagacatggtt
atcaacatggagtggggtaactttcggtcttcacaccttccactaacagaatatgaccaa
gaacttgatgctgacagtctaaaccctggagaacagatttttgaaaaaatgatttctggt
atgtatttgggagagattgtacgcagagttttgtacaagatggctgaagaagctgaattt
tttggtgatactgttccaccaaagttgaaaattcctttcatattaagaactcctcacatg
tctgcaatgcatcatgacacgtctcctgatctgaaagtggttgcaaccaaactaaaggat
atattagagatatctaatacctccctgaaaatgagaaaagttattgttgagctgtgcgac
attgttgctactcgtggtgcccgtctatctgctgccggaatcgttggcatcctcaagaaa
ctgggaagagacatagtgaaagatggtgaaaagctgaagtcagtggtagctctagatggt
ggattatatgagcactacactaaatttaggacctgcatggagaacaccctcacggagttg
ttaggagatgaagtctctgacaatattgtcattgagcactccaatgatggctctggcatt
ggggcaaccctcctggcagcctgtcactcccaatacattgaggttgaggaatcctga

DBGET integrated database retrieval system