KEGG   Theobroma cacao (cacao): 18589292Help
Entry
18589292          CDS       T02994                                 

Definition
(RefSeq) ribulose bisphosphate carboxylase small chain clone 512
  KO
K01602  
ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
tcc  Theobroma cacao (cacao)
Pathway
Glyoxylate and dicarboxylate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Carbon metabolism
Module
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Photorespiration
Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:tcc00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    18589292
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    18589292
Enzymes [BR:tcc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     18589292
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
9
AA seq 167 aa AA seqDB search
MSAGIFAAPVAGSSYVGLKTNVPKLLPAKDSIAWSRKTVSNGSRTHCMKTWNPFNNKKFE
TLSYLPPLSDDSIAKEIEYMMKKGWIPCLEFDEVGLVQRENSRIPGYYDGRYWTLWKLPM
FGCNNSSQVLNEIHECKKAYPNAYIRCLAFDSKHQAQCMSFVIQKPT
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atgtctgccggaatctttgcagctccagttgccggttctagctatgtgggcttgaaaaca
aatgttccaaagctgctcccagctaaggattctattgcatggagccggaaaactgtctcc
aatggttcaagaactcattgcatgaagacatggaatccattcaataacaagaagtttgag
acgctctcttatcttccacctctctcagatgactcgattgcgaaggaaattgagtacatg
atgaagaagggctggatcccttgccttgaatttgatgaggtggggcttgtccaaagggag
aatagcagaattccagggtactatgatggaaggtattggacactttggaagctgccaatg
tttgggtgcaacaactcctctcaagtcctgaatgaaattcatgagtgcaaaaaggcatat
ccaaatgcttatatccgctgcctggcatttgacagcaagcatcaggctcagtgcatgtcc
tttgtcatccagaaacctacctaa

DBGET integrated database retrieval system