KEGG   Theobroma cacao (cacao): 18590373Help
Entry
18590373          CDS       T02994                                 

Definition
(RefSeq) histone deacetylase 9
  KO
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
tcc  Theobroma cacao (cacao)
Brite
Enzymes [BR:tcc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     18590373
Chromosome [BR:tcc03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     18590373
   HDAC complexes
    Sin3A-HDAC complex
     18590373
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    18590373
  Chromatin remodeling factors
   NuRD complex
    18590373
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
9
AA seq 429 aa AA seqDB search
MRPKDKIAYFYDGDVGSVYFGPNHPMKPHRLCMTHHLVLAYDLHKKMEIYRPHKAYPVEL
AQFHSADYVEFLHRITPDTQHLFSNELARYNLGEDCPVFENLFEFCQIYAGGTIDAARRL
NNQLCDIAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHARVLYIDIDVHHGDGVE
EAFYFTDRVMTVSFHKYGDMFFPGTGDVKDIGEREGKFYAINVPLKDGIDDTSFTRLFKT
IISKVVEMYQPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRIVKKFNLPLLVTGGGGY
TKENVARCWTVETGVLLDTELPNEIPENEYIKYFAPECLLNIPNGHIENLNSKSYISTIK
MQVLENLRCIQHAPGVQMQEVPPDFFIPDFDEDEQNPDERMDQHTQDKQIQRDDEYYDGD
NDNDQNMDM
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgcgtccaaaggacaaaatagcctacttctacgacggagatgtagggagtgtatacttt
ggacctaatcatccaatgaaaccacatcggctttgtatgactcaccatttggttcttgcc
tatgacctccataaaaaaatggaaatttatcggcctcacaaggcgtaccccgttgagcta
gctcagttccactcagctgattatgttgagttcttacatcgaattactccagatacgcag
cacttgttctcgaatgaattggcaagatacaatcttggagaagactgccctgtctttgaa
aacttgtttgaattttgtcaaatttacgctggtggaacaatagatgctgcacgaagattg
aacaatcaactatgtgatattgccattaattgggctggtggtttacatcatgccaagaag
tgcgaggcttctggcttttgttacatcaatgacttggttttgggaatcttggagcttctg
aagtatcatgcccgtgttttgtatatagatatagatgtacatcatggtgatggtgttgaa
gaagccttttatttcactgacagggtgatgactgttagttttcacaagtatggggatatg
ttctttcctggaactggtgatgtgaaggatataggagaaagagaaggaaagttttatgcc
ataaatgtcccactcaaggatggaattgatgacactagcttcactcgattgtttaaaaca
attatttcgaaggttgttgaaatgtatcaaccaggtgcaattgttcttcaatgcggggca
gattctctcgctggggatcgcttgggctgtttcaatctctcaattgatggacatgccgaa
tgtgttagaattgtcaagaaattcaatctacctttactggttactggaggtggaggatat
acaaaagaaaatgttgcacgttgttggactgtcgaaacaggagttcttttagatacagaa
cttcctaatgaaatcccagaaaatgagtatatcaaatattttgcaccagagtgcttgttg
aatattccaaatgggcacatagagaatttaaatagcaaatcatatattagtacgatcaaa
atgcaagtgttggaaaatcttcgttgcatccaacatgctccgggtgtacagatgcaagag
gttccgcctgatttctttattcctgattttgatgaagatgagcaaaatcctgatgagcgc
atggatcagcacacccaggacaagcaaatccagcgtgatgatgaatattacgatggagac
aatgataatgatcaaaacatggatatgtga

DBGET integrated database retrieval system