KEGG   Theobroma cacao (cacao): 18590967Help
Entry
18590967          CDS       T02994                                 

Definition
(RefSeq) DNA ligase 1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
tcc  Theobroma cacao (cacao)
Pathway
tcc03030  DNA replication
tcc03410  Base excision repair
tcc03420  Nucleotide excision repair
tcc03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:tcc00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    18590967
   03410 Base excision repair
    18590967
   03420 Nucleotide excision repair
    18590967
   03430 Mismatch repair
    18590967
Enzymes [BR:tcc01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     18590967
    6.5.1.6  DNA ligase (ATP or NAD+)
     18590967
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     18590967
DNA replication proteins [BR:tcc03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    18590967
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     18590967
DNA repair and recombination proteins [BR:tcc03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     18590967
   NER (nucleotide excision repair)
    Other NER factors
     18590967
   MMR (mismatch exicision repair)
    Other MMR factors
     18590967
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase DNA_ligase_OB_2
Motif
Other DBs
NCBI-GeneID: 18590967
NCBI-ProteinID: XP_007016876
LinkDB All DBs
Position
9
AA seq 800 aa AA seqDB search
MLTFRPCHLLRHTCLSRPLNLRFPPSSSHFLPSKPSFFRPPPLFLSPLNPYSNMSSRPSA
FDALMSNARRLAAKKNSSSSSPTKKRKSLDSSPSKTQSPNSTKTQDSTEVKPDQESDING
IEKPIEDSPKANADETQKPPDSKKMKVVSVSERNAELKGKIGSLKKKPADFDPKMVACWE
KGERVPFLFLSLSFDLISNETGRIVITDIVCNMLRTVIDTTPDDLVAAVYLAANKVAPAH
EGLELGIGDASIIKALAEACGRTESQVKSQYKDKGDLGLVAQASRSSQSMMRKPDPLTVV
KVFDTFRLIAKESGKDSQEKKKNRIKALLVAATDCEPQYLIRLLQTKLRIGFSEQTLLAA
LGQAAVYNEQHSKPPPNIQSPLEEAAKIVKQVFSILPVYDKVVPALLTGGIWNLSKTCSF
TLGVPVGPMLAKPTKGVAEIVNKFQDIDFICEYKYDGERAQIHYMENGIVEIYSRNAERN
TGKFPDVVAAISRFKKSSVKSFVLDCELVAYDRVQKKILPFQILSTRARKNVVVSDIKVD
VCIFAFDILYLNGQPLLQEQLKVRKERLYDSFEEEAGFYQFATALTSNELEEIQAFLDSA
VSLSCEGLIIKTLDRDATYEPSKRSLNWLKLKKDYMESIGDTLDLVPIAAFHGRGKRTGF
YGAFLLACYDDRNEEFQSICKIGTGFTESELEERSASLRSKVIPEPKSYYRYGEMMKPDV
WFEATEVWEVKAADLTISPVHRAAIGIVDPDKGISLRFPRLVRVREDKAPEQASSSEQVA
EMYNAQKHNQANNEDDGDDD
NT seq 2403 nt NT seq  +upstreamnt  +downstreamnt
atgctgacgtttcgtccatgccatctgcttcgccatacttgtctttctcgacctctcaac
cttcgctttcctccatcttcctcccatttcctcccctctaaaccctctttctttcgccct
ccacccctctttctttcccccttaaacccttactccaacatgtcttctcgtccctccgcc
ttcgatgctctcatgtccaacgctcgccgtttagcggcaaagaaaaacagttcctcttct
tcacccaccaagaaacgcaaatccctcgattcatcgccatcgaagacccaaagccctaat
tcgaccaaaacccaggattctaccgaggtcaagcccgaccaagaaagcgatattaatgga
attgaaaagcccattgaagattccccaaaagccaatgcagatgagacgcagaaacctccc
gattcgaagaaaatgaaggtggtgagtgtgtcggagagaaatgcggaattgaaggggaaa
attgggtcactgaagaagaagccggcggattttgacccgaaaatggtggcgtgttgggag
aaaggagagagggtgccatttttgtttctttctttgtcgtttgatttgatatccaacgag
acgggtcggattgtgataacggatattgtttgtaatatgttgaggactgttattgatacg
acaccggatgatttggtggcggcggtttacttggcagcaaataaggttgctccggcgcac
gagggattagagctgggaattggggatgcctcgattatcaaggccctcgcggaggcctgt
gggaggactgaatcacaggttaagagtcagtacaaggataagggagacctgggccttgtt
gcacaagctagccgttcatctcaatcgatgatgcgcaagcctgatccattaactgttgtc
aaagtgtttgacacctttcgtctaattgctaaggaatctggaaaggatagtcaggagaag
aaaaagaatcgtatcaaggcacttcttgttgctgcaactgactgtgaacctcaatatttg
attcgtctacttcagacaaagttgcggattggattttcagagcagactctattagctgca
ttaggacaagctgctgtatataatgaacaacattctaaaccacctcctaacattcagtct
cctttagaagaggctgctaagattgtaaaacaagttttttccatccttccagtctatgat
aaagtagtgcctgctcttctgactggtggtatatggaatctttcaaagacttgtagcttt
acactgggtgtccctgtgggacctatgctagcaaaaccaaccaaaggggttgcagaaatt
gtaaataaattccaggatattgactttatatgtgaatataaatatgatggagaacgtgca
cagatacattatatggagaatggtatagttgagatatacagtcgaaatgctgagcggaac
actggaaagtttccagacgttgtagctgccatttctagattcaagaagtcctctgtaaaa
tcatttgttttggattgtgaacttgttgcttatgatcgggttcaaaagaaaattttaccc
tttcagatccttagtacaagagctcgcaaaaatgtggtagtgagtgacatcaaagttgat
gtgtgcatatttgcttttgacatcttgtatcttaatgggcaaccacttcttcaggaacaa
ctgaaagttcgtaaggagaggctttatgactcatttgaagaagaggctgggttttatcag
tttgcaacagccttaacatcaaatgaacttgaggaaatacaagcatttcttgattctgct
gtttctttaagttgtgagggcttaattatcaaaacattggatagagatgctacatatgag
ccatcaaagcggtcactcaactggctaaaattgaagaaagactacatggaaagtattgga
gacacattagatctagttcctattgctgctttccatggccgtgggaaacggactggcttc
tatggtgcatttctcttggcatgttatgatgacaggaatgaagaattccagagtatctgt
aaaataggcacgggatttactgaatcagagcttgaagaacgttctgccagtctccgctct
aaagtgattcctgaaccaaagtcatactatcgttatggagagatgatgaaaccagatgta
tggtttgaggctactgaggtttgggaggtaaaagctgcagacttgaccattagccctgtt
catcgtgcagcaattgggattgtggatcctgataagggcatatctctccgatttcctcgt
ttagttcgtgttcgagaagataaggctccagagcaagcttcatcatctgagcaggttgct
gagatgtacaatgctcaaaaacacaatcaagctaacaatgaagatgacggtgatgatgat
tga

DBGET integrated database retrieval system