KEGG   Theobroma cacao (cacao): 18596143Help
Entry
18596143          CDS       T02994                                 

Definition
(RefSeq) beta-galactosidase 17
  KO
K12309  beta-galactosidase [EC:3.2.1.23]
Organism
tcc  Theobroma cacao (cacao)
Pathway
tcc00052  Galactose metabolism
tcc00511  Other glycan degradation
tcc00531  Glycosaminoglycan degradation
tcc00600  Sphingolipid metabolism
tcc00604  Glycosphingolipid biosynthesis - ganglio series
tcc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tcc00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    18596143
  Lipid metabolism
   00600 Sphingolipid metabolism
    18596143
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    18596143
   00604 Glycosphingolipid biosynthesis - ganglio series
    18596143
   00511 Other glycan degradation
    18596143
Enzymes [BR:tcc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     18596143
Exosome [BR:tcc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   18596143
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_35 Glyco_hydro_42 BetaGal_dom4_5 p12I
Motif
Other DBs
NCBI-GeneID: 18596143
NCBI-ProteinID: XP_017978893
LinkDB All DBs
Position
6
AA seq 720 aa AA seqDB search
MNHSKKLAATESTSKSTAAMARKRSSKTTLIFFVLLSIVAFVAFVPVFASLPSLSSHSHD
LHLHLRLHQRQHRLEKSDARKFEIAEDMFWKDGKPFQIIGGDLHYFRILPEYWEDRLLRA
KALGLNTIQTYIPWNLHEPEPGKLVFEGIADLVSFLKLCQKLGLLVMLRAGPYICAEWDL
GGFPAWLLAIEPDIRLRSSDPAYLQLVEGWWGVLLPKVAPLLYGNGGPIIMVQIENEFGS
YGDDKAYLRHLVKLARGHLGEDIILYTTDGGSRETLEKGTLVGDDVFSAVDFTTGDDPWP
IFELQKEFNSPGKSPPLSSEFYTGWLTHWGEKIARTDADFTAAALEKILSRNGSVVLYMA
HGGTNFGFYNGANTGADESDYKPDLTSYDYDAPITESGDVDNAKFKAIRRVVGKYSSVSL
PSFPSSNKKTGYGFIQLQKTRSLFDLLDGFDSAHIVEAENPTAMEYFYQMFGFLLYVSEY
ASKAGGNKLFIPKVHDRAQVFISCPSRADGGRVSYVGTIERWSNQAIYLPNAKCVSNTSL
FILVENMGRVNYGPYLFDRKGILSSVYVDGRVLNRWKMIPIPFQNLNEVPKFNPVIQVAS
EFPKVSIRKKLEHKSEDVLEGPSFYTGHFSIDKTSEVTDTFISFRAWGKGIAFVNEFNIG
RYWPTSGPQCNLYIPAPILRHGENVLVIFELESPNPELVVDSVDQQDFNCGSSKASVRQL
NT seq 2163 nt NT seq  +upstreamnt  +downstreamnt
atgaatcacagtaaaaagctagctgcaacggagtcaacctccaaatcaactgcggcgatg
gcgagaaagcgaagcagcaaaacgacgttgatcttcttcgttttgctttccattgtagct
ttcgttgctttcgttcccgtcttcgcttctctcccttctctttcctctcactctcacgat
cttcacctccatcttcgtcttcatcagcgtcagcatcgtctcgaaaaaagtgatgctaga
aagtttgaaattgcggaggatatgttttggaaagatggaaagccttttcagataattggt
ggtgacttgcattatttccgcattcttcctgagtactgggaagataggcttttaagagca
aaagcactgggactgaataccattcaaacttatattccttggaatttgcatgaaccggag
cctggcaaactggtttttgaaggcattgcagatctagtatcatttctcaaactttgccag
aagttaggtctccttgttatgcttcgagctgggccttatatttgtgcagagtgggatctt
ggaggattcccagcttggttacttgccatagaaccagatatcagactaaggtcatcagat
cctgcttacctccaattggttgaaggatggtggggagtcctacttccaaaagtagctcct
cttctttatggtaatggaggtcctattataatggttcagatagaaaatgaatttgggtca
tatggagatgataaagcttatcttcgtcacctggtgaagttggctagaggacatcttggg
gaagacattattttgtatactacagatggaggttctcgagaaactcttgaaaaaggaacc
cttgtaggagatgatgtcttttccgctgttgacttcactactggggatgatccttggccc
atatttgagttacaaaaggagttcaattcccctgggaaatcaccaccactttcttcggag
ttttatacaggttggcttacacattggggtgagaagattgcaaggacagatgcagatttt
accgcagctgccttggaaaagattttgtcacgaaatggttctgtcgtgctttatatggca
catggtggaacaaactttggattttataatggggcaaatacaggtgctgatgagtcagat
tacaagcctgatctaacttcctatgattatgatgcgccaattacggagtctggtgatgtg
gacaatgcaaaattcaaagccataaggagagtggtggggaaatatagttcagtatctctt
ccttcatttccttccagtaataaaaagacaggatatggttttatccagttacaaaaaaca
agaagtttatttgatttacttgatgggtttgattctgcacacattgttgaagctgaaaat
ccaactgcaatggagtatttctaccagatgtttggatttctattatatgtatctgaatat
gcatcgaaagctggtggaaataagctatttataccaaaggtgcatgacagagctcaagtg
ttcatatcatgcccttctagagctgatggtggacgagtatcatatgttggtacaattgaa
agatggtcaaatcaagcaatttaccttcctaatgctaaatgtgtttctaacaccagctta
tttattttggttgaaaacatgggccgtgtaaattatggaccatacttgtttgacaggaag
ggaattttgtcttctgtttatgtagatgggagagttttgaacagatggaaaatgatccca
attcctttccaaaacctgaatgaggtgccaaagttcaatcctgtcattcaagttgcatct
gaattccctaaagtatccatccgcaaaaagttagagcacaagtcagaggatgttttagaa
ggaccatcattctacactggtcatttctctattgataaaactagtgaagttacagataca
ttcatttcgtttagagcctggggtaaagggattgcttttgttaatgaattcaacatcgga
agatattggccaacttcaggaccacaatgcaacctttatatccctgctccaatccttcgg
catggggaaaatgttttggtgatattcgagttagaatcaccaaaccctgagcttgtggtt
gattcagttgatcagcaagatttcaattgtggatcaagtaaagcaagtgtgcgtcaactt
taa

DBGET integrated database retrieval system