KEGG   Theobroma cacao (cacao): 18602056Help
Entry
18602056          CDS       T02994                                 

Definition
(RefSeq) ribulose bisphosphate carboxylase small chain, chloroplastic
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
tcc  Theobroma cacao (cacao)
Pathway
tcc00630  Glyoxylate and dicarboxylate metabolism
tcc00710  Carbon fixation in photosynthetic organisms
tcc01100  Metabolic pathways
tcc01200  Carbon metabolism
Module
tcc_M00165  Reductive pentose phosphate cycle (Calvin cycle)
tcc_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
tcc_M00532  Photorespiration
tcc_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:tcc00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    18602056
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    18602056
Enzymes [BR:tcc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     18602056
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RuBisCO_small RbcS
Motif
Other DBs
NCBI-GeneID: 18602056
NCBI-ProteinID: XP_007033270
UniProt: A0A061EH79
LinkDB All DBs
Position
4
AA seq 184 aa AA seqDB search
MASSMISSATVATVNRASPAQASMVAPFTGLKSTSALPVARKANNDITSLASNGGRVQCM
QVWPPLGKKKFETLSYLPDLTRERLFKEVEYLLRNKWVPCLEFELEHGFVYRENLRIPGY
YDGRCWIMWKLPMFGCTDASQVLKELDEAKKTYPTAFIRIIGFDNRRQVQCISFIAYKPP
GYEN
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atggcttcctcaatgatctcatcggcaaccgtcgccaccgttaaccgtgcctccccggca
caggccagcatggtcgccccattcaccggcctcaagtctacctctgctctcccagtcgct
cgcaaggccaacaacgacattacttctctcgcaagcaatggtggcagagtgcaatgcatg
caggtgtggcctccactggggaagaagaagtttgagactctctcatacctccctgatctc
actcgagagaggttgtttaaggaagtagaataccttcttcgcaataagtgggttccgtgc
ttggaattcgaattggagcacggattcgtgtaccgtgagaacctcaggatacctgggtac
tatgatgggcgctgctggatcatgtggaaacttcccatgttcggatgcactgacgcatcc
caggtgttgaaggagcttgatgaggccaagaagacttaccccacggcattcatcagaatc
atcggattcgacaacaggcgtcaagtgcagtgcatcagtttcattgcctacaagccccca
ggctacgaaaattaa

DBGET integrated database retrieval system