KEGG   Theobroma cacao (cacao): 18602056Help
Entry
18602056          CDS       T02994                                 

Definition
(RefSeq) ribulose bisphosphate carboxylase small chain, chloroplastic
  KO
K01602  
ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
tcc  Theobroma cacao (cacao)
Pathway
Glyoxylate and dicarboxylate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Carbon metabolism
Module
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Photorespiration
Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:tcc00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    18602056
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    18602056
Enzymes [BR:tcc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     18602056
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
4
AA seq 184 aa AA seqDB search
MASSMISSATVATVNRASPAQASMVAPFTGLKSTSALPVARKANNDITSLASNGGRVQCM
QVWPPLGKKKFETLSYLPDLTRERLFKEVEYLLRNKWVPCLEFELEHGFVYRENLRIPGY
YDGRCWIMWKLPMFGCTDASQVLKELDEAKKTYPTAFIRIIGFDNRRQVQCISFIAYKPP
GYEN
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atggcttcctcaatgatctcatcggcaaccgtcgccaccgttaaccgtgcctccccggca
caggccagcatggtcgccccattcaccggcctcaagtctacctctgctctcccagtcgct
cgcaaggccaacaacgacattacttctctcgcaagcaatggtggcagagtgcaatgcatg
caggtgtggcctccactggggaagaagaagtttgagactctctcatacctccctgatctc
actcgagagaggttgtttaaggaagtagaataccttcttcgcaataagtgggttccgtgc
ttggaattcgaattggagcacggattcgtgtaccgtgagaacctcaggatacctgggtac
tatgatgggcgctgctggatcatgtggaaacttcccatgttcggatgcactgacgcatcc
caggtgttgaaggagcttgatgaggccaagaagacttaccccacggcattcatcagaatc
atcggattcgacaacaggcgtcaagtgcagtgcatcagtttcattgcctacaagccccca
ggctacgaaaattaa

DBGET integrated database retrieval system