KEGG   Thermococcus celer: A3L02_05630Help
Entry
A3L02_05630       CDS       T05076                                 

Definition
(GenBank) type III ribulose-bisphosphate carboxylase
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
tce  Thermococcus celer
Pathway
tce00630  Glyoxylate and dicarboxylate metabolism
tce01100  Metabolic pathways
tce01120  Microbial metabolism in diverse environments
tce01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tce00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    A3L02_05630
Enzymes [BR:tce01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     A3L02_05630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N LigA
Motif
Other DBs
NCBI-ProteinID: ASI99082
UniProt: A0A218P2C9
LinkDB All DBs
Position
complement(1011582..1012916)
Genome map
AA seq 444 aa AA seqDB search
MVEKFDKIYDYYVDKGYEPNKKREVVAVFRVTPAKGYSIEAAAGAVAAESSTGTWTTLYE
WYERERWESLSAKAYDFHEMGDGSWIVKIAYPLDIFEEFNMPAFLASIAGNVYGMKRVDW
LRLEDIYLPERFLRDYPGPAFGIEGVRKKLEIYDRPLYGVVPKPKVGYSPEELYKLALDL
FSGGADYLKDDENLASPWYNRFEDRVEVVSKAMEKAESETGEKKTWFANITAPLLEMERR
LEILADYGVPHAMVDIVVLGWGVLDYIRELAEDYGIALHAHRAMHAAFDRNPRHGLSMFV
LAKLARVVGVDQIHIGTAGAGKLEGSKWDVIQYKRVITENHYVPEENDPFHMEQRFYHMK
PVFPTSSGGLHPGNIEPVIDALGKDIVLQLGGGTMGHPDGPKAGAMAARQAIDAIMQGIP
LDEYARSHRELARALEKWGHVTPV
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atggtggagaagttcgataagatatacgactactacgtggacaaaggctacgagccgaac
aaaaagcgtgaggtggtggcggttttcagggtcacccccgcgaagggttatagcatcgag
gcggccgcgggggccgtggctgcagagagctccacggggacttggacgacgctctatgag
tggtacgagagggagaggtgggagagcctttcggccaaggcctacgacttccacgagatg
ggcgacggtagctggatcgtgaagatagcctacccgctcgacatcttcgaggagttcaac
atgccggccttcctcgcgagcatcgccgggaacgtctacggcatgaagcgtgttgactgg
ctccgcctcgaggacatctacctgcctgagaggttcctccgcgattaccccggccccgct
tttggaatcgaaggggtgaggaagaagctcgagatctacgacaggcctctctacggtgtc
gtcccaaagcccaaggtcggttactctccggaggagctctacaaactcgccctcgacctg
ttctccggaggggcggactacctcaaggacgacgagaacctggcgagcccgtggtacaac
cgcttcgaggacagggttgaggtcgtatcgaaggccatggagaaggccgagagcgagacc
ggcgagaagaagacctggttcgccaacataaccgcgccgctcctcgagatggagcgcagg
ctcgagatcctcgccgactacggtgttcctcacgccatggtcgacatagtcgtcctcggc
tggggagtcctcgactacatcagggagctggccgaggactacggcatagccctccacgcc
cacagggccatgcacgcggccttcgacaggaacccgaggcacggcctctcgatgttcgtc
cttgccaagctcgcgagggtcgtcggagttgatcagatacacataggcaccgccggggcc
ggaaagctcgagggaagcaagtgggacgtcatccagtacaagagggtgatcacggagaac
cactacgtgccggaggagaacgacccgttccacatggagcagaggttctaccacatgaaa
cccgtcttcccgaccagctctggcggcctgcaccccggaaacatagagcccgtcatagac
gccctcgggaaggacatcgtcctccagctcggcggtggaacgatggggcacccggacgga
ccgaaggccggagcgatggcggcgagacaggccatagacgccatcatgcagggaatcccg
ctcgacgagtacgccaggtcccacagggagctcgcgagggcccttgagaagtggggccac
gtgactcctgtctga

DBGET integrated database retrieval system