KEGG   Thermococcus chitonophagus: CHITON_0596Help
Entry
CHITON_0596       CDS       T04536                                 

Definition
(GenBank) Ribulose-1,5-bisphosphate carboxylase, Type III
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
tch  Thermococcus chitonophagus
Pathway
tch00630  Glyoxylate and dicarboxylate metabolism
tch01100  Metabolic pathways
tch01120  Microbial metabolism in diverse environments
tch01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tch00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    CHITON_0596
Enzymes [BR:tch01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     CHITON_0596
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N B12-binding
Motif
Other DBs
NCBI-ProteinID: CUX77375
UniProt: A0A160VR55
LinkDB All DBs
Position
I:563679..564941
Genome map
AA seq 420 aa AA seqDB search
MKVEWYLDFVDLDYTPGRDELIVEYYFEPNGVSPEEAAGRIASESSIGTWTTLWKLPEMA
KRSMAKVFYLEKSGEGYIAKIAYPLTLFEEGSLVQLFSAIAGNVFGMKALKNLRLLDFHP
PYEYLRHFRGPQYGVKGIREFMGIKDRPLTATVPKPKMGWSVEEYAEIAYELWSGGIDLL
KDDENFTSFPFNRFEERVRKLYRVRDRVEAETGETKEYLINITGPVDVMERRAELVANEG
GQYVMIDIVVAGWSALQYMREVTEDLGLAIHAHRAMHAAFTRNPKHGITMFALAKAARMI
GVDQIHTGTAVGKMAGDYEEIKRINDFLLSKWEHIRPVFPVASGGLHPGLMPELIRLFGK
DLVIQAGGGVMGHPDGPKSGAKALRDAIEAAVDGIDLEEKAKSSPELKKALEKWGYLKPK
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgaaggttgagtggtacctcgattttgttgacctagactacaccccaggaagggacgag
ctcatagttgagtactacttcgagccgaatggcgtttctcctgaagaagccgctggaagg
atagcgagcgaaagctctattggaacgtggacgaccctctggaagcttccggagatggcg
aagaggagtatggcaaaggtgttctatttggagaagagtggcgaaggttatattgccaag
atagcctaccccttgaccctgtttgaggaggggagcttagtccagctcttcagcgctata
gctggcaacgtgttcgggatgaaagccctgaagaacctgagattgctcgacttccatcct
ccatacgagtacctaaggcacttcagagggcctcagtacggagttaaggggattagggaa
ttcatggggatcaaggacaggcccctaaccgcaacggttccaaagccaaagatggggtgg
agcgttgaggagtatgctgagattgcttacgagctctggagtggtggaattgacctgctt
aaggatgacgagaacttcacgagtttccccttcaacaggttcgaagagagggtgaggaag
ctctacagggtaagggacagggttgaggcagagaccggagagacaaaggagtacctgatc
aacatcacgggtccagtggatgttatggagaggagggccgaattagttgctaatgaaggc
gggcagtatgtgatgattgatatagtcgttgcaggatggagcgcgcttcagtacatgagg
gaagtcactgaagacttgggattggcaatccacgcccacagggcaatgcatgcagcattc
actaggaatccaaagcacggtataactatgtttgctttagccaaggcagcaaggatgata
ggggttgatcaaatccacaccggaacagctgtaggaaagatggcaggagattatgaagag
atcaagagaatcaacgactttctcctgagtaagtgggagcacataaggccagtgttccca
gtggcaagcggtggccttcaccccggcttgatgcctgaactgataaggctcttcggaaaa
gatctagttattcaggctggaggaggtgtcatgggtcatccagatgggccaaagtctgga
gctaaagcattaagggacgctattgaggctgcagttgatggaatagaccttgaagagaag
gcaaaatcgagccctgaactgaagaaggccttggagaagtggggctatcttaagccaaag
tag

DBGET integrated database retrieval system