KEGG   Thermococcus chitonophagus: CHITON_1497Help
Entry
CHITON_1497       CDS       T04536                                 

Definition
(GenBank) Tungsten-containing formaldehyde:ferredoxin oxidoreductase
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
tch  Thermococcus chitonophagus
Pathway
tch00030  Pentose phosphate pathway
tch01100  Metabolic pathways
tch01120  Microbial metabolism in diverse environments
tch01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tch00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    CHITON_1497
Enzymes [BR:tch01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     CHITON_1497
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_C AFOR_N
Motif
Other DBs
NCBI-ProteinID: CUX78276
UniProt: A0A160VUI5
LinkDB All DBs
Position
I:complement(1393588..1395447)
Genome map
AA seq 619 aa AA seqDB search
MKGWWGRILRVNLTTGEVKVQEYPEEIAKKFIGGRGLAAWILWNEVKNVDPLSPENKLIF
ASGPFNGLPTPSGGKMVVAAKSPLTGGYGDGNLGTMATVHLRKAGYDALVVEGKAKKPVY
IYIEDDNVSILSAEGLWGKGTFETERELKKIHGKNVGILSIGPAGENLVRYAVVMSQEGR
AAGRPGMGAVMGSKNLKAVVIKGTKEIPVADKDELRKLSQEAYEAILNAPGYPFWKRQGT
MAAVEWTNENYALPTRNFQDGQFEFARSIDGYTLEGMKVKQRGCPYCNMPCGNVVLDAEG
QESELDYENVALLGSNLGIGKLNEVAVLNRIADDMGMDTISLGVSIGFVMEAKEKGLLKE
GPEFGDFKGAKQLAYDIAYRRGELGNFAAEGVMRMAEKLGDDSFAMHVKGLEVSGYNSYI
YPAMALAYGTSSIGAHHKEAWVIAWEIGTAPIEGEQAKKVEYKITYDPIKAQKVVELQRL
RGGLFEMLTACRLPWVEIGLSLDYYPKLLKAITGVTYTWDDLYTAADRLYALIRAYWVRE
FNGNWDRTKDYPPKRWFVDSLKSGPYKGQHLDKEKYDALLSEYYRIRGWDERGIPKKETL
QKLGLDFVISELEKVTKLE
NT seq 1860 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggctggtggggaaggattcttagagttaacttgaccacgggagaagtaaaagtt
caggaatatcccgaagaaattgcaaaaaagttcattggaggtaggggattagccgcgtgg
attttgtggaatgaagttaagaacgttgatcctctcagccccgagaacaaattaatattt
gcttcaggccccttcaacggtctcccaactccaagcggtggaaagatggttgtcgcagcc
aagagccccctcacgggcggttatggtgacggtaacctaggtacaatggcaaccgttcac
ctgagaaaggctggttacgatgctttggttgttgagggtaaggcaaagaaacccgtttac
atctacattgaagatgataacgtgagcattttgagtgctgaaggattgtggggtaaggga
accttcgagaccgagagggagcttaagaagatacatgggaagaatgttggaattctcagc
ataggtcccgccggtgagaacctagttaggtacgctgttgtaatgtcacaggagggaagg
gccgcaggaaggcccggaatgggtgctgtaatgggaagcaagaacctgaaggctgtggta
attaagggtacaaaggaaataccagttgctgacaaggatgaactaagaaagctcagccag
gaggcttatgaggcaattctcaacgccccaggatatccgttctggaagagacagggaaca
atggctgcagtagagtggactaacgagaactatgcactgccaacgagaaacttccaggat
ggccagttcgaattcgcaaggtcaattgatggttatacgctagagggaatgaaggtcaag
cagagaggctgtccgtactgtaacatgccctgtggaaacgttgtcctggatgctgaagga
caggagagcgaacttgactatgagaacgttgccttattaggctcaaaccttgggattgga
aagctaaatgaagtagctgtccttaacaggattgcagatgacatgggtatggatacgata
agccttggagtctcaataggatttgtcatggaggctaaggagaaaggacttctcaaggaa
ggtccagagtttggtgacttcaaaggtgctaaacaactcgcttatgacatagcctacaga
agaggcgaacttggcaacttcgcagccgagggagtcatgagaatggcagagaagctgggg
gatgacagcttcgcaatgcacgttaagggcctagaggttagcggatacaacagctacatc
tatcctgcaatggccctagcttacggaacttcatcaataggtgcccaccacaaggaggct
tgggtaatagcatgggagataggaacggcaccaattgagggagagcaggctaagaaggtc
gagtacaagataacctatgatccaataaaggctcagaaagtcgttgagttgcagaggctc
aggggtggactctttgagatgctcaccgcatgtaggctcccatgggttgaaatcggcttg
agcctagactactatccaaagctcctcaaggcgataactggggttacatacacatgggat
gacctgtacacggcagctgacaggctctatgcacttatcagggcttactgggttagggag
ttcaatggcaactgggatagaaccaaggactatccaccaaagaggtggttcgttgattcc
ctcaagagtggtccatacaagggccagcaccttgacaaggagaagtacgatgcactgctc
tcagagtactacaggattaggggctgggacgagaggggaattccgaagaaggaaaccctt
cagaagcttggccttgacttcgtcatttcagagcttgagaaagttacgaagctcgagtga

DBGET integrated database retrieval system