KEGG   Tatumella citrea: A7K98_06345Help
Entry
A7K98_06345       CDS       T04873                                 

Gene name
gpmA
Definition
(GenBank) phosphoglyceromutase
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
tci  Tatumella citrea
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:tci00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A7K98_06345 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    A7K98_06345 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    A7K98_06345 (gpmA)
Enzymes [BR:tci01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     A7K98_06345 (gpmA)
Membrane trafficking [BR:tci04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    A7K98_06345 (gpmA)
Exosome [BR:tci04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   A7K98_06345 (gpmA)
  Exosomal proteins of melanoma cells
   A7K98_06345 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(1333489..1334241)
Genome map
AA seq 250 aa AA seqDB search
MAVTKLVLVRHGESQWNQENRFTGWYDVDLSEKGRGEAKAAGKLLKDEGFSFDFAYTSVL
KRAIHTLWNVLDELDQVWLPVEKSWRLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFA
VTPPELDRSDERFPGHDPRYASLTAEQLPTTESLALTIERVIPFWEQSILPRIKSGEKVI
IAAHGNSLRALIKYLDNMSEDEILELNIPTGVPLVYEFDENFKPLKHYYLGNADEIAAKA
AAVANQGKAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggcagtaaccaagcttgttctggtacgtcacggcgaaagccagtggaatcaggaaaac
cgctttaccggctggtacgatgtggacctgtctgaaaagggccgcggagaagcaaaagcc
gcagggaagttactgaaagatgaaggtttcagcttcgactttgcttatacgtcggttctg
aagcgtgctatccatactctttggaatgtactggatgaacttgatcaggtctggctgccg
gttgagaaatcctggcgcctgaacgaacgccattacggcgcactgcaaggcctgaataaa
gcagaaaccgcagaaaaatacggtgatgagcaggtaaaacagtggcgtcgtggttttgca
gtaactccaccggaactggatcgtagtgatgagcgtttccccggccatgacccgcgttat
gcctctttaaccgctgaacaattgccaaccaccgaaagcctggcgctgaccattgagcgc
gttattccattctgggaacagtctattctgccacgcattaaaagcggtgagaaagtgatc
attgcggcgcatggtaactctctgcgggcattgatcaaatatctggacaacatgtcagaa
gatgaaattctggaactgaatattcctaccggggttccactggtatatgagtttgatgaa
aacttcaaaccactgaaacactattacctgggtaatgccgacgaaatcgcagctaaagct
gctgccgtcgcgaaccagggtaaagcgaagtaa

DBGET integrated database retrieval system