KEGG   Thermomonospora curvata: Tcur_3455Help
Entry
Tcur_3455         CDS       T01127                                 

Definition
(GenBank) D-alanine/D-alanine ligase
  KO
K01921  
D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
tcu  Thermomonospora curvata
Pathway
D-Alanine metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:tcu00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    Tcur_3455
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Tcur_3455
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    Tcur_3455
Enzymes [BR:tcu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Tcur_3455
Peptidoglycan biosynthesis and degradation proteins [BR:tcu01011]
 Precursor biosynthesis
  Amino acid ligase
   Tcur_3455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
3973946..3974956
Genome map
AA seq 336 aa AA seqDB search
MRIAVLFGGASSEREVSIASAAQVFTALRDRGHDVIAIDTAKGKLSPQEVEAFVSATVAY
DPPGVDDIPASEVTARLTAEDSELRGVDVVFLALHGGSGEDGTLQALLKAAGIPYTGSGV
LGSAVAMDKDMSKRLFRQAGVPTPDWIMAPATAAEVAERIGFPAIVKPNSQGSTIGLTVV
KAPEQLEEAIATAAAWDHEVMIERFVPGRELVVGVLDGRALAVGEIVPQLGEIFDYQSKY
QVGGAVETFPADLPAETAAEVQRLAVAAHRALKLGSYSRIDFRLDAQGRLWCLEANTLPG
MTATSLMPQSAAAVGIGFAELCERLCELALAEHRGR
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgcggatcgccgtgttgttcggaggcgccagctcggaacgggaggtttcgatcgccagc
gccgcacaggtgttcaccgcactgcgcgaccgcggccacgacgtcatcgccatcgacacc
gccaaggggaagctgagcccgcaggaggtggaggcgttcgtcagcgccaccgtcgcctac
gacccgcccggagtggacgacatcccggcctcggaggtgaccgcccggctgaccgccgag
gacagcgagctgcgcggcgtggacgtggtgttcctggcgctgcacggcggctccggcgag
gacggcaccctgcaggcgctgctgaaggccgccggcatcccctacaccggcagcggagtg
ctgggcagcgccgtggcgatggacaaggacatgtccaagcggctgttccggcaggccggc
gtgcccacccccgactggatcatggcgcccgccaccgccgccgaggtggccgagcggatc
ggcttcccggccatcgtcaagcccaactcccagggctccaccatcgggctcaccgtggtc
aaggcgcccgagcagctggaggaggcgatcgccaccgccgccgcctgggaccacgaggtg
atgatcgagcggttcgtgcccggccgcgagctggtggtcggggtgctggacgggcgggcg
ctggcggtcggggagatcgtcccgcagctgggggagatcttcgactaccagagcaagtac
caggtcggcggggcggtggagaccttccccgccgacctgccggcagagaccgccgccgag
gtgcagcgcctggcggtggccgcgcaccgggcgctcaagctgggctcctacagccggatc
gacttccggctggatgcgcagggccggctgtggtgcctggaggccaacacgctgcccggc
atgaccgccaccagcctgatgccgcagtcggcggcggcggtgggcatcggtttcgccgag
ctgtgcgagcggctgtgcgagctcgccctggccgagcaccgcggccgctga

DBGET integrated database retrieval system