KEGG   Candidatus Tenderia electrophaga: Tel_04475Help
Entry
Tel_04475         CDS       T04171                                 

Definition
(GenBank) branched-chain alpha-keto acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
tee  Candidatus Tenderia electrophaga
Pathway
tee00010  Glycolysis / Gluconeogenesis
tee00020  Citrate cycle (TCA cycle)
tee00620  Pyruvate metabolism
tee01100  Metabolic pathways
tee01110  Biosynthesis of secondary metabolites
tee01120  Microbial metabolism in diverse environments
tee01130  Biosynthesis of antibiotics
tee01200  Carbon metabolism
Module
tee_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:tee00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tel_04475
   00020 Citrate cycle (TCA cycle)
    Tel_04475
   00620 Pyruvate metabolism
    Tel_04475
Enzymes [BR:tee01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Tel_04475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H Biotin_lipoyl_2 HlyD_3 Herpes_DNAp_acc DUF1180
Motif
Other DBs
NCBI-ProteinID: ALP52460
UniProt: A0A0S2TBC9
LinkDB All DBs
Position
962051..963358
Genome map
AA seq 435 aa AA seqDB search
MSKEIKVPNIGDFSEVEVIEVLVSPGDRIKPEDSLISVESDKAAMEIPAPEGGEVKEVKV
KVGDKVSEGSLILLLEPANDAAAETQPAAEQAQPSKEEEKAEEKPKPEAPAQPPPAPKKE
AAAAPRQSPTAAINEESFSKAHATPAVRKFARELGVDLGQVDGSGRKGRITKDDVQGFVK
RALSQPAAGGLGVAPMPEIDFSQWGEVEAQPLSKINKLTGQFLHRNWVTIPHVTQFDEAD
ITDMEKFRKEMAAEYKEKGIKITPLVFMMKAVVSALREFPRFNSSLDATGENLILKRYFN
VGIAVDTPDGLVVPVVRDVDRKSLVDLAAELGEISAKARDKKLKPADMQGGSITISSLGG
IGGTKFTPIVNAPEVAILGVSRAKMQPVWNGKEFEPRLMLPLSLSYDHRVIDGADGARFT
TFLSRVLSDTRRLLL
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaagaaatcaaagttccgaatattggtgacttctccgaggtggaggtgatcgag
gtgctggtatctccgggcgaccgcatcaagcccgaggactcgctgatttcggtggagtcg
gacaaggccgccatggagatccccgccccggaaggcggcgaggtcaaagaggtcaaggtc
aaggtgggggacaaggtctccgagggcagtctgatcctattgctggaaccggccaatgac
gccgcggccgaaacgcagccggccgctgaacaggcgcagccgtccaaggaggaggaaaag
gccgaggagaaacccaagcctgaggcgcccgcgcagcccccgccggcgcctaaaaaagag
gcagcggccgcgccgcgccagtcgcccaccgccgccatcaacgaggagtcattctccaag
gcccacgccacgccggcggtgcgcaagttcgcccgtgagctgggcgtggacctgggccag
gtggacggcagcggccgtaagggccgtatcaccaaggacgatgtgcagggcttcgtcaaa
cgcgccctgtcacagccggccgccggcggtctgggcgtggcgcccatgcccgagatcgat
ttcagccagtggggcgaggtcgaggcccagcccctgtccaagatcaacaaactcaccggc
caattcctgcatcgcaactgggtcaccatcccgcacgtcacccagttcgacgaggcggat
atcaccgacatggaaaaattccgcaaggagatggccgccgaatacaaggaaaagggcatc
aagatcacccccctggtgttcatgatgaaggcggtggtgtcagcgctgagagagtttccg
cgctttaattcatcgctggatgcgaccggcgagaacctgatcctgaaacgttatttcaat
gtgggcatcgcggtggacaccccggacggtttggtagtgccggtggtgcgcgatgtggat
cgcaagagcctggtggacctggcggcggagttgggcgagatcagcgccaaggcgcgtgac
aaaaagctcaagccggccgacatgcagggcggcagtatcaccatctccagcctgggcggt
atcggcggcaccaagttcacgcccatcgtgaacgcccccgaagtggccatcctcggtgtg
tcgcgcgccaagatgcagccggtgtggaacggtaaggaattcgagccgcgcctgatgttg
ccgctgtcattgtcctacgatcaccgcgtcatcgacggcgccgatggcgcccggttcacc
accttcctcagccgcgtgctgtccgacacccgccggttgctgttgtga

DBGET integrated database retrieval system