KEGG   Tenacibaculum sp. LPB0136: LPB136_11415Help
Entry
LPB136_11415      CDS       T04588                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
ten  Tenacibaculum sp. LPB0136
Pathway
ten00620  Pyruvate metabolism
ten00680  Methane metabolism
ten01100  Metabolic pathways
ten01120  Microbial metabolism in diverse environments
ten01200  Carbon metabolism
Module
ten_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:ten00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    LPB136_11415
  Energy metabolism
   00680 Methane metabolism
    LPB136_11415
Enzymes [BR:ten01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     LPB136_11415
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: APG65933
UniProt: A0A1L3JLG5
LinkDB All DBs
Position
2509455..2512034
Genome map
AA seq 859 aa AA seqDB search
MATQPKLIRFNQNVLSKYQIYNSIFMTLPFDTITKTGALLPLFHETCQKGFSQKDNPTTI
VETFFKKYQSSRSKESQTNLLFRFIQYIERQVVLFDAIEDAAFPFVNNMDGIGTLRSLKE
NATAENKLEALKAYLEEFKVRIVLTAHPTQFYPGSVLGIITDLTEAIRENDLLKINDLLA
QLGKTPFFKHEKPTPYDEAVSLIWYLENVFYKSFGSIYDYIQQNIFDGEHINNDIINIGF
WPGGDRDGNPFVTPEITLKVANRLRETVIKNYYRDIRRLRRKLTFEDVENRITILERELY
KMITNQESDLTLTSFNSELKEIKQVIIDKHQSLYVTEVNSLLNKIHLFGFHFANLDIRQD
SRKHEQFFNDMVNALIESGSAIFPKNYHDLPESEQVKLLSKVEGAVDLSLIKDEETLKAL
NTMKAIKTIQTTNGEVAANRYIISNNQTTLHVMQLFAMLKLVAFQDKLTVDVGPLFETIT
DLENAPQVMEDLYTNPEYAAHLKSRGNKQTIMLGFSDGTKDGGYLMANWAIYKAKENLTT
ISRKYGVTVIFFDGRGGPPARGGGKTHNFYASLGPTIEDKEVQLTIQGQTISSNFGTLDS
SQYNLEQLISSGIYNSLSDKDLSMLPENREVMTDLSERSYKAYSDFKAHPKFISYLEYMS
TLKYYAKTNIGSRPSKRGKAEGLVFEDLRAIPFVGSWSQLKQNVPGFFGVGTALKHYEDT
NTFEKVQTLFKTSDFFKTLIENSMMSLSKSFFDLTKYMSEDEEYGGFWNVIYEEYKTSKR
LLLKLTGYTELMQEEPAGSASIAVRESIVLPLLTIQQYALKKIQELEKAETKDEEQIKVY
EKLVTRSLFGNINASRNSA
NT seq 2580 nt NT seq  +upstreamnt  +downstreamnt
atggcaacacaaccaaaactcataaggtttaatcaaaacgtactgtctaaatatcagata
tataacagtatatttatgactttgccttttgatacaattactaaaacaggtgctctttta
ccacttttccatgagacttgccagaaaggattttctcaaaaagataaccctacaactatt
gtagaaacgttttttaaaaaatatcaatctagtagatcaaaagagagtcagactaattta
ttattcagattcattcaatatatagagcgtcaagttgtattatttgatgctattgaagat
gctgcttttccatttgtgaataacatggatggtattggaacgttgcgtagtttaaaagaa
aatgcaactgctgaaaataaattagaagcacttaaagcttaccttgaagaatttaaagta
cgtattgtattaacggcccatccaacacagttttatccaggttcagttttaggtattatt
actgatttaactgaagctatacgtgaaaatgatttacttaaaataaacgatcttttagca
cagttaggaaaaaccccattttttaaacatgaaaaacctacaccttatgatgaggctgtt
agtttaatatggtatttagaaaatgtgttttataaatcttttgggtcaatttacgattac
attcaacaaaatatttttgacggagaacacattaataatgatattataaatattggtttt
tggccaggaggagatagagatggaaatccatttgtaactccagaaataacattaaaagta
gctaatagattacgagaaacagttattaaaaactattatcgtgacattagaagattaaga
agaaaattaacatttgaagatgtagaaaaccgtataactatattagaacgtgagttatat
aaaatgattactaatcaagaatcagatttaactttaacgtcttttaattctgaattaaag
gaaataaaacaagtaattattgataaacatcaatcgctttatgttactgaagtaaatagt
ttattgaataaaattcaccttttcggattccattttgcaaatttagatattagacaagat
agtagaaaacacgaacagttttttaatgatatggtaaacgctttaattgaaagtggtagt
gctatatttcctaaaaattatcatgatttaccagaaagcgaacaagtaaaattattgtct
aaagttgaaggcgcagtagatttatctttaattaaagatgaagaaacgctgaaggcttta
aatacaatgaaagctataaaaaccattcaaactacaaatggtgaagtagcagcaaaccgt
tatattattagtaataatcaaacaactttacatgttatgcagttgtttgcaatgctaaaa
ttagttgcttttcaagataaattaacagttgatgttgggcctttatttgaaactattaca
gatttagaaaatgcgcctcaagtaatggaagatttgtatacaaatcctgaatatgctgcg
catttaaaatctagaggaaacaagcaaacaattatgcttggttttagtgatggaacaaaa
gatggtggttatttaatggcaaattgggcaatctataaagcaaaagagaacctaactaca
atctcaagaaaatacggtgttactgttatattctttgatggtcgtggtggacctccagct
cgtggtggtggaaaaacacataatttttatgcttctctaggaccaacaattgaagataaa
gaagtacaattaacaatacaaggacaaacaattagttctaattttggaacattagattcg
tctcaatacaacctagaacaattaattagttcaggtatttataatagtttaagcgataaa
gatttaagtatgcttcctgaaaatagagaagtaatgacagatttatctgaacgaagctat
aaggcatattcagattttaaggcgcatccaaaattcatttcgtatttagagtacatgagt
actttaaaatattatgcaaaaactaatattggaagtcgcccatcaaaaagaggaaaggca
gaaggtttagttttcgaagatttaagagcaataccttttgtaggttcttggagtcagtta
aaacaaaatgtacctggcttttttggagttggtactgctttaaaacattatgaagacaca
aatacatttgaaaaagtacaaactttatttaaaacttctgatttctttaaaacattgatt
gaaaacagcatgatgtcgttatcaaaatcattttttgatttaacaaaatacatgagtgaa
gatgaagagtacggtggtttctggaatgttatttatgaagaatacaaaacttctaaacga
ttacttctaaaacttactggttatacagaacttatgcaagaagagccggcaggaagtgcc
tctattgcagttagagagtctatagttttaccactgttaacaatacagcaatatgcttta
aagaaaatacaggagcttgaaaaagcagaaactaaagatgaagaacaaataaaagtttat
gagaaacttgttacacgttctctatttggtaatataaatgctagtagaaattctgcataa

DBGET integrated database retrieval system