KEGG   Tessaracoccus sp. NSG39: BW730_00185Help
Entry
BW730_00185       CDS       T04732                                 

Definition
(GenBank) phosphoenolpyruvate mutase
  KO
K01841  
phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
tes  Tessaracoccus sp. NSG39
Pathway
Phosphonate and phosphinate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:tes00001]
 Metabolism
  Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    BW730_00185
Enzymes [BR:tes01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     BW730_00185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
34035..35342
Genome map
AA seq 435 aa AA seqDB search
MSESKSVYIAISSDILHRGHLRIIEAGAELGEVTVGLLTDRAIATYKRLPVLGWESRVAL
VSSMRSVARVVEQDSLSYADNLRQLRPDYVVHGDDWRTGKQSLVRAEVLSVLAEYGGELV
EVPYTSGVSGTEVERGLRPLMNTADRRRGKLRQLLALKPFLRVMEVSNGLSALIVENVHT
EDPEEIAPREYDAMWVSSLCDSSFKGKPDIELVDFTSRMNTIHEIMEVSSKPIIVDGDTG
GRIEHFSYTVRTLERAGVSAVIIEDKTGLKQNSLFGTDAVQTLDDPEAFAAKILAGKRAQ
VSRDFMIFARLESLIAGAGIEDALSRASVYLAAGADGIMIHSKEKDGSEIREFLAQFRAG
HPDVPVVVVPTTYNHIHEDELSEMGANIIIHANHLLRSAYPAMFNTAKKILECGRSKEVD
DEIMPIKDVLKLIPE
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaatccaaatcggtctacatcgccatttcgtccgatattctccaccgaggccat
ctgaggatcatcgaggccggagcggaactgggcgaggtaaccgtcggtctgttgaccgac
cgggcgatcgccacctacaagaggctgccggtgctcggctgggagtcgcgggtcgcgctc
gtgtcgagcatgcgctcggtcgcccgggtggtcgagcaggactcgctgtcctacgcagac
aacctccgtcagcttcgccccgactatgtggtgcacggcgacgactggcgcacaggtaag
cagtccctcgtccgggctgaggtgctgtcggtgctcgccgagtacggcggcgaactcgtc
gaggtcccctacacctccggcgtctccggcaccgaggtcgagcgcggcctgcgcccgctg
atgaacacggccgaccgccgccgcggcaagctgcgccaactgctggcgctgaagcccttc
ctgcgtgtcatggaggtctccaacggcctcagcgcgctgatcgtggagaacgtccacacc
gaggaccccgaggagatcgcgccccgcgagtacgacgccatgtgggtcagcagcctctgc
gactccagcttcaagggcaagcccgacatcgaactggtcgacttcacgagccggatgaac
accatccacgagatcatggaggtctccagcaagccgatcatcgtcgacggtgacaccgga
ggcaggatcgagcacttcagctacacggtgcgcaccctggagcgcgcaggcgtctccgcg
gtcatcatcgaggacaagacgggcctgaagcagaactcgctcttcggcaccgacgcggtg
cagaccctcgacgatcccgaggcattcgcggccaagatcctcgcgggcaagcgcgcccag
gtgtcgcgtgacttcatgatcttcgcccgcctggagagcctgatcgcaggcgcaggcatc
gaggacgccctttcccgcgcctccgtctacctggcggccggggccgacggcatcatgatc
cactccaaggagaaggacggcagcgagatccgcgagttcctcgcgcagttccgcgcaggc
cacccggacgtgcccgtcgtcgtggtgcccaccacctacaaccacatccacgaggacgaa
ctgagcgagatgggggcgaacatcatcatccacgccaaccatctgctgcgcagcgcctac
cccgcgatgttcaacactgccaagaagatcctggagtgtggccggagcaaggaagtcgac
gacgagatcatgcccatcaaggacgtcctgaagttgattcccgaatga

DBGET integrated database retrieval system