KEGG   Thermoanaerobacter sp. X514: Teth514_0851Help
Entry
Teth514_0851      CDS       T00648                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  
elongation factor Tu
Organism
tex  Thermoanaerobacter sp. X514
Brite
Translation factors [BR:tex03012]
 Eukaryotic Type
  Elongation factors
   Teth514_0851
 Prokaryotic Type
   Teth514_0851
Mitochondrial biogenesis [BR:tex03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    Teth514_0851
Exosome [BR:tex04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Teth514_0851
  Exosomal proteins of breast cancer cells
   Teth514_0851
  Exosomal proteins of colorectal cancer cells
   Teth514_0851
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
887786..888988
Genome map
AA seq 400 aa AA seqDB search
MAKQKFERKKPHVNVGTIGHVDHGKTTLTAAITMVLSKAGMAEAKGYDEIDKAPEEKARG
ITINTTHVEYETEKRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLARQVGVPYIVVFLNKADMVDDPELIELVEMEVRELLNEYEFPGDDTPIVVGSALKALE
CGCGKRECEWCGKIWQLMDIVDEYIPTPERDIDKPFLMPVEDVFTITGRGTVATGRVERG
KVKVGDEVEIIGLTTESRKTVVTGVEMFRKTMDEAQAGDNIGVLLRGVQRDEVERGQVLA
KPGTIKPHTKFEAQVYVLTKEEGGRHTPFFNGYRPQFYFRTTDVTGVINLPDGVEMVMPG
DHVTIKVELITPIAMEEGLKFAIREGGRTVGAGVVSAIIE
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagcaaaaatttgagaggaagaagccgcacgtaaacgtagggacgataggtcac
gtagaccatggtaagacgacattgacagcagcgataacgatggtattatcgaaggcagga
atggcagaggcgaagggatatgacgagatagacaaggcaccagaggagaaagcaagggga
ataacgataaacacgactcacgtagaatatgagacagagaagaggcactatgcgcacgta
gactgtccaggtcacgcagactatgtaaagaacatgataacaggggcagcgcagatggat
ggagcgatattggtagtatcagcagcagacggtccgatgccacagacgagggagcacata
ttattggcgaggcaggtaggagtgccatatatagtagtatttttaaacaaggcagacatg
gtagacgatccagaattaatagaattagtagagatggaagtaagggaattattaaacgaa
tatgaatttcctggggatgacacaccgatagtagtaggatcagcattaaaggcattagaa
tgtggatgtggcaagagagagtgtgaatggtgcggtaagatatggcagttaatggatata
gtagacgaatatataccgacaccggagagagacatagacaagccatttttgatgccagta
gaggacgtatttacgataacaggaaggggaactgttgcgacaggaagagtagagagaggg
aaggtaaaggtaggagacgaagtagagataataggattgacgacagaatcgaggaagaca
gtagtaacaggagtagagatgttcaggaagacgatggatgaagcgcaagcaggggacaac
ataggagtattattaagaggagtacagagggacgaagtagagagagggcaagtattagcg
aagccagggacgataaagccgcacacgaaatttgaggctcaagtttacgtattgacgaag
gaagagggaggaaggcacacaccatttttcaatggatacaggccacaattttactttagg
acgacagacgtgacaggggtaataaacctgccggatggagtagagatggtgatgccaggt
gaccacgtaacgataaaagtagagttaataacaccgatagcgatggaagaaggtttgaag
tttgctataagagaaggcggccgtacagtaggtgctggcgtcgtgtcagctatcatagaa
taa

DBGET integrated database retrieval system