KEGG   Tessaracoccus sp. T2.5-30: BKM78_01450Help
Entry
BKM78_01450       CDS       T04747                                 

Gene name
kgd
Definition
(GenBank) alpha-ketoglutarate decarboxylase
  KO
K00164  
2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
tez  Tessaracoccus sp. T2.5-30
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Tryptophan metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:tez00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BKM78_01450 (kgd)
  Amino acid metabolism
   00310 Lysine degradation
    BKM78_01450 (kgd)
   00380 Tryptophan metabolism
    BKM78_01450 (kgd)
Enzymes [BR:tez01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     BKM78_01450 (kgd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
299567..303349
Genome map
AA seq 1260 aa AA seqDB search
MSAPDSLDSFGANAWLIDEMREAYQADPSSVDPEWRKLFETEGAPAQPTAAPPAPQAAEQ
PSEAQPAVTPAPPQQSAKPVEAAKGDGEPKDQPAADGEAAPARPAQKSMVERRPKGGERP
ANPGSGSTLSANAPNPALRPEPTAAQPKYTVLRGAPMRTAKNMESSLTVPTATSVRSVPM
KLVIDQRTVINNFLRTSKGGKVSFTHLIGYAMVKALAAMPDMNNAYDVVDGKPTLIENPS
INLGIAIDIRKGDTRQLLVPNIKGCENLNFFQFWSAYEQVVKKTRDGDLQVSDFAGTTAS
LTNPGGIGTNHSVPRLMNGQGVILGVGNIDYPAEFQGMSPSKLTELGVSKVTTLTSTYDH
RVIQGATSGEFLKKLHGLLLGEDRFYDEIFEALRIPYEPLRWSPDISAHRDSQVSKTARV
LELVNAYRTFGHLVADTDPLEYRQRAHEDLRLEAHGLSIWDLDREFAVGTFGGKERVYLP
LRDIIGILQDSYTRTIGVEYMHIADPRQREWFQQRMERPHTPLTHEEHMHALDKLNEAEV
FETFLQTKFVGQKRFSLEGGESLIVLLDEIAQRAANDSLDEVCIGMPHRGRLNVLANVVG
KKYAQIFKEFDGQVDRTGTGDVKYHLGAEGTFVAANGATIKASVAANPSHLEAVNPVLQG
IARAKQDTLAADDYPVLPLTLHGDASFSGQGVVFETLQMSQLRGYKTGGTIHVVVNNQVG
FTTAPTESRSSTYCTDVAKSISAPVLHVNGDDPDACIRAARVAFDYRQRYHKDVVIDLIC
YRRRGHNEGDDPSFTQPNMYDLIEQKRSTRRLYTESLIGRGDISMADAEDVMNRFRARLE
NVFREVRETTEADDDYRKVPYYPTKPDARLTEITPEMLRTIAEVHTQFPDGFTVHPKVMP
QLERRAHAILEGPIDWATAEMIAIGSLLMERRPVRLAGQDSRRGTFSQRFAAIVDRVTNE
AWVPLKHLTEDQGTFDVFDSLLSEYAALGFEYGYSVARPDALVMWEAQFGDFVNGAQIIS
DEFVAAGNAKWTQKSGVVLLLPHGYEGQGPDHSSARIERWLQLCAENALAVCQPSTPASY
FHLLRQHAYVNYHRPVVIATPKSMLRNKLATSHPEDFTSGAWHPVLDDPTIDDPSKVKRL
ILCSGKVRWDLVARREQLGHDGSIAIVALERLYPLPSEELARALQRYAHVDDVRFVQDEP
ENQGAWPFLSVHLPGDVKRHLPDYDLTMTLVAREWSSAPSVGSLKVHKGQEEDLLTAALG
NT seq 3783 nt NT seq  +upstreamnt  +downstreamnt
atgtcagcacctgactcactggactctttcggggcgaatgcatggctgatcgacgagatg
cgggaggcctaccaggccgatcccagctccgtcgatccggaatggcgcaagctgttcgag
actgagggggctcccgcgcagcccaccgccgcgccacccgcccctcaggcggccgagcag
ccgtccgaggcacagcccgccgtgacccccgcaccgccgcagcagagcgccaagcccgtc
gaggcggcgaagggcgatggggagcccaaggaccagcccgccgccgacggcgaggccgca
ccggcccggcccgcgcagaagtccatggtggagcggcggcccaagggcggcgagcgcccg
gccaaccccggctccgggtcgacgctgtcggccaacgcccccaaccccgcgctgcggccc
gagcccaccgccgcgcagccgaagtacacggtcctgcgcggcgccccgatgcgcacggcc
aagaacatggagtcgtcgctgacggtcccgacggccacctccgtccgctccgtccccatg
aagctcgtcatcgaccagcgcacggtcatcaacaacttcctgcgcacctccaagggcggg
aaggtctccttcacgcacctgatcggctacgcgatggtcaaggcgctggcggccatgccg
gatatgaacaacgcctacgacgtcgtcgacggcaagcccaccctcatcgagaacccctcc
atcaacctcggcatcgccatcgacatccgcaagggcgacacccgacagctgctggtgccc
aacatcaagggctgcgagaacctcaacttcttccagttctggtccgcctacgagcaggtg
gtcaagaagacccgcgacggcgacctgcaggtcagcgacttcgcgggcacgacggcgtcg
ctcaccaaccccggcggcatcggcaccaaccactccgtgcctcgcctcatgaacgggcag
ggcgtcatcctcggcgtcggcaacatcgactatccggccgagttccagggcatgagcccg
tcgaagctcaccgagctgggcgtgtccaaggtcacgaccctcaccagcacgtacgaccac
cgcgtcatccagggcgccacctccggcgagttcctcaagaaactccatggcctgctcctc
ggcgaggaccggttctacgacgagatcttcgaggctctgcgcatcccctacgagcccctg
cgctggtcaccggacatctcggcgcaccgtgactcgcaggtgagcaagacggcccgcgtg
ctggagctggtcaacgcgtaccgcacgttcggccacctcgtcgcggacaccgatccgctc
gagtaccggcagcgggcgcacgaggacctgcgcctcgaggcgcacggcctgtcgatctgg
gacctggaccgcgagttcgcggtcgggaccttcggcggcaaggagcgcgtctacctgccg
ctgcgcgacatcatcggcatcctgcaggactcctacacccgcaccatcggcgtcgagtac
atgcacatcgccgacccgcgtcagcgcgagtggttccagcagcggatggagcggccgcac
acgccgctgacgcacgaggaacacatgcacgcgctggacaagctcaacgaggccgaggtc
ttcgagacgttcctgcagacgaagttcgtgggtcagaagcgcttctcgctggagggcggc
gagtcgctgatcgtgctgctggacgagatcgcccagcgggccgcgaacgactccctcgac
gaggtgtgcatcggcatgccgcaccgcggccgcctcaacgtgctcgccaacgtcgtcggg
aagaagtacgcccagatcttcaaggagttcgacggccaggtcgaccgcaccggcaccggc
gacgtcaagtaccacctcggcgcggagggcaccttcgtcgcggccaacggcgccaccatc
aaggcgtcggtcgcggcgaacccgtcgcacctcgaggcggtcaacccggtgctccagggc
atcgcccgcgccaagcaggacacgctggcggccgacgactacccggtcctgccgctgacg
ctgcacggcgacgcgtcgttctcgggccagggcgtggtgttcgagaccctgcagatgagt
cagctgcgcggatacaagaccggtggcaccatccacgtggtcgtcaacaaccaggtgggg
ttcacgacggcgccgacggagtcgcgcagctcgacgtactgcacggacgtcgccaagtcg
atctccgcacccgtcctgcacgtcaacggcgacgacccggacgcctgcatccgggccgcc
cgcgtcgcgttcgactaccggcagcgctaccacaaggacgtcgtcatcgacctcatctgc
taccgccgccgcggccacaacgagggcgacgacccgagcttcacgcagccgaacatgtac
gacctcatcgagcagaagcgctcgacgcggcgcctctacaccgagtccctcatcggccgc
ggcgacatctccatggccgacgccgaggacgtcatgaaccggttccgcgcccgcctcgag
aacgtgttccgcgaggtgcgcgagaccaccgaggccgacgacgactaccgcaaggtgccc
tactacccgacgaagcccgacgcccggctcaccgagatcaccccggagatgctcaggacg
atcgcggaggtgcacacgcagttccccgacgggttcacggtgcacccgaaggtcatgccg
cagctcgagcgccgcgcgcacgcgatcctcgagggaccgatcgactgggcgacggccgag
atgatcgccatcggctcgctgctcatggagcgccggcccgtgcggttggccggccaggac
tcgcggcgcggcacgttctcgcagcgcttcgccgccatcgtggaccgggtcaccaacgag
gcctgggtgccgctcaagcacctcaccgaggaccagggcacgttcgacgtgttcgactcg
ctgctcagcgagtacgccgcgctcggcttcgagtacgggtactcggtggcacgcccggac
gcgctggtgatgtgggaggcccagttcggcgacttcgtcaacggcgcccagatcatctcc
gacgagttcgtcgccgccggcaacgcgaagtggacccagaagtccggtgtggtgctgctg
ctccctcacggctacgagggtcagggcccggaccacagctcggcgcgcatcgagcgctgg
ctgcagctgtgcgcggagaacgcgctggccgtgtgccagccgtcgacaccggccagctac
ttccacctgctgcgccagcacgcctacgtcaactaccaccgccccgtggtgatcgcgacg
cccaagtcgatgctgcgcaacaagctggccacgtcccatccggaggacttcacctccggc
gcctggcacccggtgctggacgacccgaccatcgacgacccgtcgaaggtcaagcgcctc
atcctctgctccgggaaggtgcgctgggacctcgtcgcccgccgagagcagctcggccac
gacggcagcatcgcgatcgtcgcgctcgagcggctgtacccgctgcccagcgaggagctc
gcgcgggcgctgcagcgatacgcgcacgtcgacgacgtgcgattcgtgcaggacgagccg
gagaaccagggggcctggcccttcctgtccgtgcacctgcccggcgacgtcaagcgccac
ctgccggactacgacctcaccatgacactggtggcccgcgagtggtcgtcggcgccgtcg
gtgggctcgctcaaggttcacaagggccaggaggaggacctcctcaccgcggcgctaggc
tga

DBGET integrated database retrieval system