KEGG   Tessaracoccus sp. T2.5-30: BKM78_11615Help
Entry
BKM78_11615       CDS       T04747                                 

Definition
(GenBank) isocitrate dehydrogenase (NADP(+))
  KO
K00031  
isocitrate dehydrogenase [EC:1.1.1.42]
Organism
tez  Tessaracoccus sp. T2.5-30
Pathway
Citrate cycle (TCA cycle)
Glutathione metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:tez00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BKM78_11615
  Metabolism of other amino acids
   00480 Glutathione metabolism
    BKM78_11615
Enzymes [BR:tez01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     BKM78_11615
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(2516643..2518856)
Genome map
AA seq 737 aa AA seqDB search
MGKIIYTLTDEAPLLATYSFLPIINAFAGQAGVAVETRDISLAGRILAQFTDRLPEDQRV
DDALTELGELAKTPDANIIKLPNVSASVPQLKAAVAELQSQGFQLPDYPEDPQTDEEREV
RARYDRVKGSAVNPVLREGNSDRRAPESVKNYAKKNPHRMGAWSSDSRTRVATMDANDFR
HNEQSVILPSADTLTIRHRSADGTETVLKESLAVLEGEVVDATVMRASALDAFLREQVAA
AKESGVLFSVHLKATMMKVSDPIIFGHVIEAFLPEVFERFGADLAAAGLSPNDGLGAILA
GLDSLPNGADIRAAIEQGIADGPRLAMVNSDKGITNLHVPSDVIVDASMPAMIRQSGHMW
GPDGEEDDTLAVLPDSSYAGVYQAVIEDCQANGAFDPRTMGSVPNVGLMAQKAEEYGSHD
KTFEIPSDGVVEVVDASGSVLMSHDVAAGDIWRACQTKDAPVQDWVKLAVTRARVTGAPA
VFWLDEERAHDRNLIEKVRGYLADHDTDGLQIEIMNPVDATRFSVERIRRGEDTISVTGN
VLRDYLTDLFPILELGTSAKMLSVVPLMAGGGLFETGAGGSAPKHVQQLVEQNYLRWDSL
GEFLALAASFEHLADREGNARAKVLADTLDRANARFLDQDKSPTRRVGGIDNRGSHFYLA
LYWAQELAAQSDDAALAKVFGPVAEKLAASEQQIVDELIAVQGSPADIGGYYRPDDAKAT
AVMRPSDTFNGIIATLD
NT seq 2214 nt NT seq  +upstreamnt  +downstreamnt
atgggcaagatcatctacaccctcaccgacgaggccccgctgctcgccacgtattccttc
ctccccatcatcaacgcgttcgccggccaggccggggtggcggtcgagacccgcgacatc
tcgctcgcgggccgcatcctcgcccagttcaccgaccggctgccggaggaccagcgggtc
gatgacgcgctcaccgagctcggcgagctggcgaagacgccggacgccaacatcatcaag
ctgcccaacgtgtccgcgtccgtcccgcagctcaaggccgcggtcgccgaactccagagc
cagggcttccagctccccgactaccccgaggatccgcagaccgacgaggagcgcgaggtc
cgcgcccgctacgaccgcgtcaaggggtccgcggtcaacccggtgctgcgcgagggcaac
tccgaccgccgcgcgcccgagtcggtgaagaactacgcgaagaagaacccgcaccgcatg
ggcgcctggtcgagcgactcccgcacccgcgtggccacgatggacgccaatgacttccgg
cacaacgaacagtccgtcatcctcccctccgccgacacgctgaccatccggcaccgctcc
gccgacggcactgagaccgtcctcaaggagtcgctggcggtgctcgagggggaggtcgtc
gacgccacggtgatgcgggcatccgccctggacgcgttcctgcgcgagcaggtggccgcg
gcaaaggagagcggcgtgctgttctccgtgcacctcaaggcgacgatgatgaaggtctcg
gacccgatcatcttcggccacgtcatcgaggcgttcctgcccgaggtgttcgagcgcttc
ggcgccgatctcgcggcggccggcctctcccccaacgacgggctgggcgcgatcctcgcc
gggctcgattccctccccaacggcgccgacatccgggccgcgatcgagcagggcatcgct
gacggcccgcggcttgcgatggtgaactccgacaagggcatcaccaacctgcacgtcccg
tcggacgtcatcgtcgacgcctcgatgcccgccatgatccgccagtccggccacatgtgg
ggtcccgacggcgaggaggacgacacgctcgcggtgctgcccgactcgtcgtacgccggc
gtctaccaggcggtcatcgaggactgtcaggccaacggtgccttcgacccgcgcaccatg
ggctcagtcccgaacgtgggcctcatggcgcagaaggccgaggagtacggctcgcacgac
aagaccttcgagatcccgtccgacggcgtcgtcgaggtcgtcgacgcgtccggctccgtg
ctcatgagccacgacgtggccgcgggcgacatctggcgcgcctgccagaccaaggacgcc
cccgtccaggactgggtcaagctcgccgtcacgcgcgcccgcgtcaccggggcgcccgcc
gtgttctggctcgacgaggagcgcgcgcacgaccgcaacctcatcgagaaggtgcgcggc
tacctcgccgaccacgacaccgacggcctccagatcgagatcatgaacccggtcgacgcc
acgcggttcagcgtcgagcggatccgccggggcgaggacaccatctcggtgaccggcaac
gtcctgcgcgactacctgaccgacctgttccccatcctggaactcggcacgtcggccaag
atgctctcggtcgtgccgctgatggcgggtggcggcctcttcgagaccggcgccggcggc
tccgcaccgaagcacgtgcagcagttggtggagcagaactacctccgctgggactccctg
ggcgagttcctcgccctcgcagcgtcgttcgagcacctcgccgaccgcgagggcaatgcc
cgcgccaaggtcctggccgacacgctggaccgcgctaacgcccgcttcctcgaccaggac
aagtccccgacgcgccgcgtcggcgggatcgacaaccgcggctcccacttctacctggcg
ctctactgggcccaggagctggcggcccagtccgatgacgccgcgctggcgaaggtgttc
ggcccggtcgcggagaagctggccgcctccgagcagcagatcgtcgacgagctgatcgcc
gtgcagggctccccggccgacatcggcggctactaccgccccgacgacgccaaggccacc
gcggtcatgcgcccgtcggacacgttcaacggaatcatcgccacgctggactga

DBGET integrated database retrieval system