KEGG   Tessaracoccus sp. T2.5-30: BKM78_11615Help
Entry
BKM78_11615       CDS       T04747                                 

Definition
(GenBank) isocitrate dehydrogenase (NADP(+))
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
tez  Tessaracoccus sp. T2.5-30
Pathway
tez00020  Citrate cycle (TCA cycle)
tez00480  Glutathione metabolism
tez01100  Metabolic pathways
tez01110  Biosynthesis of secondary metabolites
tez01120  Microbial metabolism in diverse environments
tez01130  Biosynthesis of antibiotics
tez01200  Carbon metabolism
tez01210  2-Oxocarboxylic acid metabolism
tez01230  Biosynthesis of amino acids
Module
tez_M00009  Citrate cycle (TCA cycle, Krebs cycle)
tez_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:tez00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BKM78_11615
  Metabolism of other amino acids
   00480 Glutathione metabolism
    BKM78_11615
Enzymes [BR:tez01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     BKM78_11615
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH
Motif
Other DBs
NCBI-ProteinID: AQX16483
LinkDB All DBs
Position
complement(2516643..2518856)
Genome map
AA seq 737 aa AA seqDB search
MGKIIYTLTDEAPLLATYSFLPIINAFAGQAGVAVETRDISLAGRILAQFTDRLPEDQRV
DDALTELGELAKTPDANIIKLPNVSASVPQLKAAVAELQSQGFQLPDYPEDPQTDEEREV
RARYDRVKGSAVNPVLREGNSDRRAPESVKNYAKKNPHRMGAWSSDSRTRVATMDANDFR
HNEQSVILPSADTLTIRHRSADGTETVLKESLAVLEGEVVDATVMRASALDAFLREQVAA
AKESGVLFSVHLKATMMKVSDPIIFGHVIEAFLPEVFERFGADLAAAGLSPNDGLGAILA
GLDSLPNGADIRAAIEQGIADGPRLAMVNSDKGITNLHVPSDVIVDASMPAMIRQSGHMW
GPDGEEDDTLAVLPDSSYAGVYQAVIEDCQANGAFDPRTMGSVPNVGLMAQKAEEYGSHD
KTFEIPSDGVVEVVDASGSVLMSHDVAAGDIWRACQTKDAPVQDWVKLAVTRARVTGAPA
VFWLDEERAHDRNLIEKVRGYLADHDTDGLQIEIMNPVDATRFSVERIRRGEDTISVTGN
VLRDYLTDLFPILELGTSAKMLSVVPLMAGGGLFETGAGGSAPKHVQQLVEQNYLRWDSL
GEFLALAASFEHLADREGNARAKVLADTLDRANARFLDQDKSPTRRVGGIDNRGSHFYLA
LYWAQELAAQSDDAALAKVFGPVAEKLAASEQQIVDELIAVQGSPADIGGYYRPDDAKAT
AVMRPSDTFNGIIATLD
NT seq 2214 nt NT seq  +upstreamnt  +downstreamnt
atgggcaagatcatctacaccctcaccgacgaggccccgctgctcgccacgtattccttc
ctccccatcatcaacgcgttcgccggccaggccggggtggcggtcgagacccgcgacatc
tcgctcgcgggccgcatcctcgcccagttcaccgaccggctgccggaggaccagcgggtc
gatgacgcgctcaccgagctcggcgagctggcgaagacgccggacgccaacatcatcaag
ctgcccaacgtgtccgcgtccgtcccgcagctcaaggccgcggtcgccgaactccagagc
cagggcttccagctccccgactaccccgaggatccgcagaccgacgaggagcgcgaggtc
cgcgcccgctacgaccgcgtcaaggggtccgcggtcaacccggtgctgcgcgagggcaac
tccgaccgccgcgcgcccgagtcggtgaagaactacgcgaagaagaacccgcaccgcatg
ggcgcctggtcgagcgactcccgcacccgcgtggccacgatggacgccaatgacttccgg
cacaacgaacagtccgtcatcctcccctccgccgacacgctgaccatccggcaccgctcc
gccgacggcactgagaccgtcctcaaggagtcgctggcggtgctcgagggggaggtcgtc
gacgccacggtgatgcgggcatccgccctggacgcgttcctgcgcgagcaggtggccgcg
gcaaaggagagcggcgtgctgttctccgtgcacctcaaggcgacgatgatgaaggtctcg
gacccgatcatcttcggccacgtcatcgaggcgttcctgcccgaggtgttcgagcgcttc
ggcgccgatctcgcggcggccggcctctcccccaacgacgggctgggcgcgatcctcgcc
gggctcgattccctccccaacggcgccgacatccgggccgcgatcgagcagggcatcgct
gacggcccgcggcttgcgatggtgaactccgacaagggcatcaccaacctgcacgtcccg
tcggacgtcatcgtcgacgcctcgatgcccgccatgatccgccagtccggccacatgtgg
ggtcccgacggcgaggaggacgacacgctcgcggtgctgcccgactcgtcgtacgccggc
gtctaccaggcggtcatcgaggactgtcaggccaacggtgccttcgacccgcgcaccatg
ggctcagtcccgaacgtgggcctcatggcgcagaaggccgaggagtacggctcgcacgac
aagaccttcgagatcccgtccgacggcgtcgtcgaggtcgtcgacgcgtccggctccgtg
ctcatgagccacgacgtggccgcgggcgacatctggcgcgcctgccagaccaaggacgcc
cccgtccaggactgggtcaagctcgccgtcacgcgcgcccgcgtcaccggggcgcccgcc
gtgttctggctcgacgaggagcgcgcgcacgaccgcaacctcatcgagaaggtgcgcggc
tacctcgccgaccacgacaccgacggcctccagatcgagatcatgaacccggtcgacgcc
acgcggttcagcgtcgagcggatccgccggggcgaggacaccatctcggtgaccggcaac
gtcctgcgcgactacctgaccgacctgttccccatcctggaactcggcacgtcggccaag
atgctctcggtcgtgccgctgatggcgggtggcggcctcttcgagaccggcgccggcggc
tccgcaccgaagcacgtgcagcagttggtggagcagaactacctccgctgggactccctg
ggcgagttcctcgccctcgcagcgtcgttcgagcacctcgccgaccgcgagggcaatgcc
cgcgccaaggtcctggccgacacgctggaccgcgctaacgcccgcttcctcgaccaggac
aagtccccgacgcgccgcgtcggcgggatcgacaaccgcggctcccacttctacctggcg
ctctactgggcccaggagctggcggcccagtccgatgacgccgcgctggcgaaggtgttc
ggcccggtcgcggagaagctggccgcctccgagcagcagatcgtcgacgagctgatcgcc
gtgcagggctccccggccgacatcggcggctactaccgccccgacgacgccaaggccacc
gcggtcatgcgcccgtcggacacgttcaacggaatcatcgccacgctggactga

DBGET integrated database retrieval system