KEGG   Tessaracoccus flavescens: BW733_03990Help
Entry
BW733_03990       CDS       T04703                                 

Definition
(GenBank) isocitrate dehydrogenase (NADP(+))
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
tfa  Tessaracoccus flavescens
Pathway
tfa00020  Citrate cycle (TCA cycle)
tfa00480  Glutathione metabolism
tfa01100  Metabolic pathways
tfa01110  Biosynthesis of secondary metabolites
tfa01120  Microbial metabolism in diverse environments
tfa01130  Biosynthesis of antibiotics
tfa01200  Carbon metabolism
tfa01210  2-Oxocarboxylic acid metabolism
tfa01230  Biosynthesis of amino acids
Module
tfa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
tfa_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:tfa00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BW733_03990
  Metabolism of other amino acids
   00480 Glutathione metabolism
    BW733_03990
Enzymes [BR:tfa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     BW733_03990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH
Motif
Other DBs
NCBI-ProteinID: AQP50115
UniProt: A0A1Q2CVI0
LinkDB All DBs
Position
808041..810254
Genome map
AA seq 737 aa AA seqDB search
MGKIIYTLTDEAPLLATFSLLPIVSAFAGKAGVDVETRDISLAGRILAQFPDVLPQEQRV
DDALTELGELAKTPEANIIKLPNISASVPQLKAAIAELQAQGFALPDYPEDPASDAERET
RARYDRVKGSAVNPVLREGNSDRLAPESVKNYARKNPHRMGAWTPESKTSVSTMDSDDFR
HNEQSVVLPSDDVLSIVFTGADGSEQVLKDGLKVLEGEVVDSTVMRAAALDAFLAKQIAA
AKASGVLFSVHLKATMMKVSDPIIFGHVIKAFFPDVFATYGADLAAAGLSANDGLGAILA
GLDALPNGAEIRAAFEKGLADGPELAMVNSDKGITNLHVPSDVIVDASMPAMIRQSGHMW
GPDGEEADTLAVIPDSSYAGVYQAVIEDCIANGAFDPRTMGTVPNVGLMAQKAEEYGSHD
KTFELDADGVVEVRNAAGEVLMSHDVHAGDIWRACQTKDAPIQDWVKLAVSRARATGWPT
VFWLDPERAHDRDLIGKVNAYLADHDTEGLDIQILSPVEATKLSIERIRRGENTISVTGN
VLRDYLTDLFPILELGTSAKMLSIVPLMAGGGLFETGAGGSAPKHVQQLVAENYLRWDSL
GEFLALAASFEHLAEAEGNARAALLASTLDRANGSFLDNDKSPTRRLGGIDNRGSHYWLG
RYWAEELAAQTEDAELAAVFAPIAAALAEGEEAIVAELIGVQGNPADIGGYYRPDEAKAA
SVMRPSATLNEIIDSLA
NT seq 2214 nt NT seq  +upstreamnt  +downstreamnt
atgggcaagatcatctacaccctcaccgacgaggcacccctgctggccaccttctcgttg
ctgcccatcgtcagcgccttcgcgggcaaggcgggcgtcgacgtcgagacccgcgacatc
tcgctcgccggccgcatcctcgcccagttccccgacgtgctcccccaggagcagcgggtc
gacgacgccctgaccgagctcggcgagctggcgaagacgccggaggccaacatcatcaag
ctgcccaacatctcggcctccgtgccgcagctcaaggcggccatcgccgagctgcaggcg
cagggcttcgcgcttcccgactacccggaggacccggcatccgatgccgagcgtgagacc
cgcgcgcgctacgaccgcgtgaagggctccgccgtcaacccggtgctgcgcgagggcaac
tcggatcgtctcgcccccgagtcggtcaagaactacgcacgcaagaacccgcaccgcatg
ggcgcctggacgccggagtcgaagacttcggtctccacgatggactccgacgacttccgc
cacaacgagcagtcggtcgtgttgccgtccgacgacgtgctcagcatcgtcttcacgggt
gccgacggctccgagcaggtcctcaaggacggcctgaaggtgctggagggcgaggtcgtc
gactccaccgtcatgcgcgccgcggccctcgacgcgttcctggccaagcagatcgcagcc
gcaaaggcctccggcgtgctgttctcggtgcatctgaaggcgaccatgatgaaggtctcc
gatccgatcatcttcggccacgtgatcaaggccttcttccccgacgtcttcgcgacctac
ggcgccgacctcgccgcggcgggcctctccgccaatgacggcctcggcgcgatcctggcc
ggtctcgacgcgctgcccaacggcgccgagatccgtgcggcgttcgagaagggtctggcc
gacggcccggagctcgccatggtcaactccgacaagggcatcaccaacctgcatgtcccc
tcggatgtgatcgtcgatgcctcgatgcccgcgatgatccgccagtcgggccacatgtgg
ggccctgacggcgaggaggccgacacgctggccgtgatccccgactcgtcctacgcgggt
gtctaccaggccgtgatcgaggactgcatcgccaacggcgccttcgatccgcgcaccatg
ggcaccgtgccgaacgtgggcctgatggcgcagaaggccgaggagtacggctcgcacgac
aagaccttcgaactggacgccgacggcgtcgtcgaggttcgcaacgccgctggcgaggtc
ctgatgagccacgacgtgcacgcgggcgacatctggcgcgcctgccagaccaaggacgcc
ccgatccaggactgggtcaagctcgccgtctcccgcgcccgcgccaccgggtggcccacg
gtgttctggctcgacccggagcgcgcacacgaccgcgacctgatcgggaaggtcaacgcc
tacctcgccgaccatgacaccgagggtctcgacattcagatcctcagccccgtcgaggcg
acgaagctctcgatcgagcggatccgccgcggcgagaacaccatctccgtgaccggcaac
gtcctgcgcgactacctgaccgacctgttcccgatcctcgagcttggaacgtcggcgaag
atgctctcgatcgtcccgctgatggccgggggcggcctgttcgagactggcgccggcggc
tctgcacccaagcacgtgcagcagctggtcgcggagaactacctgcgctgggactcgctc
ggcgagttcctcgcgctcgccgcctcgttcgagcacctcgccgaggctgagggcaacgcg
cgcgccgcgctcctcgccagcacgcttgaccgcgcaaacggctccttcctcgacaacgac
aagtccccgacgcgtcgtctcggcggcatcgacaaccgcggatcccactactggctcggt
cgctactgggccgaggagctcgcggcccagaccgaagacgccgagcttgcggcggtcttc
gcgcccatcgcagcggccctcgccgagggcgaggaggcgatcgtcgccgaactgatcggc
gtccagggcaacccggccgacatcggcggctactaccgccccgatgaggcgaaggccgcc
tccgtgatgcgaccctcggccacgctgaacgagatcatcgactcgctcgcctga

DBGET integrated database retrieval system