KEGG   Tessaracoccus flavus: RPIT_02410Help
Entry
RPIT_02410        CDS       T04688                                 

Definition
(GenBank) isocitrate dehydrogenase (NADP(+))
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
tfl  Tessaracoccus flavus
Pathway
tfl00020  Citrate cycle (TCA cycle)
tfl00480  Glutathione metabolism
tfl01100  Metabolic pathways
tfl01110  Biosynthesis of secondary metabolites
tfl01120  Microbial metabolism in diverse environments
tfl01130  Biosynthesis of antibiotics
tfl01200  Carbon metabolism
tfl01210  2-Oxocarboxylic acid metabolism
tfl01230  Biosynthesis of amino acids
Module
tfl_M00009  Citrate cycle (TCA cycle, Krebs cycle)
tfl_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:tfl00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RPIT_02410
  Metabolism of other amino acids
   00480 Glutathione metabolism
    RPIT_02410
Enzymes [BR:tfl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     RPIT_02410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH
Motif
Other DBs
NCBI-ProteinID: AQP43812
UniProt: A0A1Q2CCG9
LinkDB All DBs
Position
complement(548441..550654)
Genome map
AA seq 737 aa AA seqDB search
MGKIIYTLTDEAPLLATYSFLPIVESFAGQAGVDVETRDISLAGRILAQFADRLPAEQQV
DDALSELGELAKTPEANIIKLPNISASVPQLKAAITELQAQGFALPDYPEDPQTDEDRET
RARYDRVKGSAVNPVLREGNSDRRAPESVKNYAKKNPHRMGAWDAGSKTAVATMDEGDFR
HNEQSVVLPAADVLTIRHRAADGTETILKDGLKVLADEVVDATVMRAAALDDFLRNQVAA
AKDSGVLFSVHLKATMMKVSDPIIFGHVIRAFFPAVFEQYGADLAAAGLSPNDGLGAILA
GLDALPNGAEIRAAFEQGLADGPELAMVNSDKGITNLHVPSDVIVDASMPAMIRQSGHMW
GPDGEEADTLAVLPDSSYAGVYQAVIEDCKANGAFDPTTMGTVPNVGLMAQKAEEYGSHD
KTFEMKADGVVEVVNSAGDVLMSHEVGAGDIWRACQAKDAPIQDWVKLAVSRASATGWPA
VFWLDPERAHDLNLIEKVKTYLADHDTEGLTIEILSPVEATKYTIERLRRGENTISVTGN
VLRDYLTDLFPILELGTSAKMLSVVPLMAGGGLFETGAGGSAPKHVQQLVEENYLRWDSL
GEFLALAASFEHLAQAEGNDRAGVLATTLDRATGQFLDNDKSPTRRLGGVDNRGSHYWLA
RYWAEELATQSDDARLAEIFRPVADALTEAEETIVSELIAVQGSPADIGGYFRPDDQKAA
AVMRPSATFNQIIDSIG
NT seq 2214 nt NT seq  +upstreamnt  +downstreamnt
atgggcaagatcatctacaccctcaccgacgaggccccccttctcgccacgtattccttc
ctcccgatcgtcgagagcttcgccggtcaggctggtgtcgacgtcgagacccgagacatt
tcgctggccggacgcatcctggcgcagttcgccgaccgtctccccgccgagcagcaggtc
gacgacgccctgtccgagctgggcgagcttgcgaagacgccggaggccaacatcatcaag
ctgccgaacatctcggcctccgtcccgcagctcaaggccgcgatcacggaactgcaggct
cagggcttcgcactaccggactacccggaagatccccagaccgacgaggatcgggaaacc
cgcgcacgctacgaccgggtgaaggggtccgccgtcaacccggttctccgcgaagggaac
tctgaccgtcgggcgcccgagtcggtcaagaactacgcgaagaagaacccgcaccgcatg
ggcgcctgggacgctggctccaagaccgccgtcgccacgatggatgagggcgacttccgc
cacaacgagcagtctgtcgtgctgcccgccgccgatgtgctgaccatccggcaccgtgcc
gcggacggcaccgagaccatcctcaaggacggtctcaaggtgctcgcggacgaggtggtg
gacgccaccgtcatgcgtgcggccgctctcgacgatttcctccgcaaccaggtggcggcc
gcgaaggactccggggttctcttctcggtccacctcaaggcgacgatgatgaaggtctcc
gacccgatcatcttcggccacgtcatccgcgccttcttccccgcggtgttcgagcagtac
ggcgccgacctcgccgcggcgggcctctcccccaacgacggcctcggcgcgatcctcgct
ggcctcgacgccctccccaacggggcggagatccgcgcggcgttcgagcaggggctggcg
gacgggccggagcttgccatggtgaactccgacaagggcatcaccaacctgcatgtgccc
tccgacgtcatcgtggacgcctcgatgcccgcgatgatccggcagtcgggccacatgtgg
ggccccgacggcgaggaggccgacacgctcgcggtcctgcccgactcgtcgtacgccggc
gtctaccaggccgtgatcgaggactgcaaggccaacggcgccttcgacccgacgacgatg
ggcacggtccccaatgtcgggctcatggcgcagaaggccgaggagtacggctctcacgac
aagaccttcgagatgaaggccgacggtgtcgtcgaggtggtcaactcggccggagacgtg
ctgatgagccacgaggtcggcgcgggcgatatctggcgcgcctgccaggccaaggacgcg
ccgatccaggactgggttaagctcgccgtcagccgagccagcgccaccgggtggccggcg
gtgttctggctcgaccccgagcgcgcgcacgatctgaacctcatcgagaaggtcaagacc
tacctggccgaccacgacacggagggcctcacgatcgagatcctttcgcccgtcgaggcc
acgaagtacacgatcgagcgcctccggcgcggcgagaacacgatttcggtcaccggcaac
gtgctgcgcgattatctgaccgacctgttcccgatcctcgaacttggcacctccgccaag
atgctgtccgtcgtaccgctcatggccggcggaggcctgttcgagacgggtgccggcgga
tcggcgcccaagcatgtccagcagttggtggaggagaactatctgcgatgggactcgctg
ggcgagttcctggcgttggccgcgtcgttcgagcacctggctcaggccgagggcaacgat
cgggctggcgtgctggccacgaccttggatcgggcgaccgggcagttcctcgacaacgac
aagtcccccacgcgccggctgggcggggtcgacaaccgcggatcccactactggttggcc
cgctactgggccgaggagctcgccacgcagtccgacgacgcccgactggcggagatcttc
cgccccgtcgccgacgccctgaccgaagcagaggagaccatcgtctcggaactcatcgca
gtccagggatcccccgccgacatcggcggctacttccgtcccgacgaccagaaggcggcg
gccgtcatgcgcccgtcggccaccttcaaccagatcatcgacagcatcggctga

DBGET integrated database retrieval system