KEGG   Tannerella forsythia: BFO_2207Help
Entry
BFO_2207          CDS       T01682                                 

Definition
(GenBank) BNR/Asp-box repeat protein
  KO
K01186  
sialidase-1 [EC:3.2.1.18]
Organism
tfo  Tannerella forsythia
Pathway
Other glycan degradation
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:tfo00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    BFO_2207
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    BFO_2207
Enzymes [BR:tfo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     BFO_2207
Bacterial toxins [BR:tfo02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   BFO_2207
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2362503..2364122
Genome map
AA seq 539 aa AA seqDB search
MKKFFWIIGLFASMQMTRAADSVYVQNPQIPILVDRTDNVLFRIRIPDATKGDVLNRLTI
RFGNEDKLSEVKAVRLFYAGTEAATKGRSRFAPVTYVSSHNIRNTRSANPSYSIRQDEVT
TVANTLTLKTRQPMVKGINYFWVSVEMDRNTSLLSKLTSTVTEVVINDKPAVIAGEQAAV
RRMGIGVRHAGDDGSASFRIPGLVTTNKGTLLGVYDVRYNNSVDLQEHIDVGLSRSTDKG
QTWEPMRIAMSFGETDGLPSGQNGVGDPSILVDERTNTVWVVAAWTHGMGNARAWTNSMP
GMTPDETAQLMMVKSTDDGRTWSESTNITSQVKDPSWCFLLQGPGRGITMRDGTLVFPIQ
FIDSLRVPHAGIMYSKDRGETWHIHQPARTNTTEAQVAEVEPGVLMLNMRDNRGGSRAVS
ITRDLGKSWTEHSSNRSALPESICMASLISVKAKDNIIGKDLLLFSNPNTTEGRHHITIK
ASLDGGVTWLPAHQVLLDEEDGWGYSCLSMIDRETVGIFYESSVAHMTFQAVKIKDLIR
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagtttttttggattattggtttgtttgcatcgatgcagatgacacgcgcggcg
gacagtgtttacgtacaaaacccacagatccccatcctcgtcgatcggacggacaatgtg
ctgttccgtatccgtattcctgacgcgacgaaaggcgatgtgctgaaccggctgaccata
cgcttcggtaacgaagacaagctgtcggaggtgaaagccgttcgtctgttttatgccggt
acggaagcggccacaaaaggccgttcccgttttgcgccggtgacgtatgtctcttcgcac
aatattcgtaacacgcgttcggccaacccgtcctattccatccggcaggatgaagtgacg
accgttgcaaatacattgacgctgaaaacacgtcagccgatggtgaaaggcatcaactat
ttttgggtgagtgtggagatggatcgtaacacttcgctactgtcgaagctcacctcgacg
gtgacggaagtggttatcaacgataagccggccgttattgccggcgaacaggccgctgtg
cgccgtatggggatcggggtgcgtcatgcgggcgacgacggatcagcctctttccgtatt
cccggattagtgacaacgaacaaaggaacattgctcggggtctatgatgtacgttacaat
aacagtgtagatttacaggagcatatcgacgtggggctgagccgcagcaccgacaaaggt
cagacatgggaaccgatgcgcattgccatgtcgttcggtgagaccgacggattaccgtcg
gggcagaatggagtcggcgatccgtccatcctcgtcgatgaacgcacgaacaccgtctgg
gttgttgccgcatggacgcacgggatgggcaatgcgcgcgcatggaccaattccatgccc
ggaatgacacccgatgaaacagcccaactgatgatggtgaaaagtacggacgacggccga
acatggagcgaatcgaccaacatcacgtctcaggtgaaagatccttcgtggtgcttcctg
ctgcaaggtccgggaagaggaatcacaatgcgggacggcacgcttgtcttcccgatccag
tttatcgactccctacgtgtccctcacgcgggtattatgtacagcaaagaccgtggagag
acgtggcatatccatcagccggcgcgtaccaacacgacggaggcgcaagtggccgaggta
gagccgggcgtgctcatgctgaacatgcgtgacaatcgtggcggcagccgtgccgtcagc
attacacgcgacttgggaaaaagttggacggaacactcgtcgaaccgcagcgccttgccg
gaatcgatctgtatggcgagcctgatcagcgtcaaagcgaaagataacatcatcgggaaa
gacctgttgctcttctcgaatcccaacacgacggaaggacgccatcacatcaccatcaag
gcgagcctcgacggaggtgttacgtggcttcctgcacatcaggtacttctcgacgaagaa
gacggatggggctactcgtgtctgtcgatgatcgaccgcgaaacggtcgggatattttac
gaatcgagtgtggcacacatgacctttcaggctgttaaaatcaaagacctgatacgatga

DBGET integrated database retrieval system