KEGG   Thermococcus gorgonarius: A3K92_01145Help
Entry
A3K92_01145       CDS       T05047                                 

Definition
(GenBank) aldehyde ferredoxin oxidoreductase
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
tgg  Thermococcus gorgonarius
Pathway
tgg00030  Pentose phosphate pathway
tgg01100  Metabolic pathways
tgg01120  Microbial metabolism in diverse environments
tgg01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tgg00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    A3K92_01145
Enzymes [BR:tgg01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     A3K92_01145
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_C AFOR_N
Motif
Other DBs
NCBI-ProteinID: ASJ00188
LinkDB All DBs
Position
193205..195022
Genome map
AA seq 605 aa AA seqDB search
MYGNWGRFLRVNLSTGEIKVEEYDEELAKKWLGSRGLAIYFLLRDMDPKVDPLSPENKLI
ITPGPLSGTSAPTGGRYNVVTKSPLTGFITMANSGGYFGAELKFAGWDGIIVEGKAESPV
YIYIKDDNVEIRDASHLWGKVVSETEEAIKKEIGSKKLHIASIGPAGENLVKFAAVMNDG
HRAAGRAGVGAVMGSKNLKAIAVEGSKQVPIADRQKFMLTVREKINKLRNDPVAGGGLPK
YGTAVLVNIINENGLYPTRNFQTGVFEHAYEQSGEAMTAKYLIKNQPCYACPIGCGRVNK
LPTVGVTEGPEYESIWALGANLGINDLASIIEANHQCDEFGLDTISTGGTLAAAMELYEK
GYLTDEELGDAPPFRWGNTEVLHYYIEKIAYRKGIGDKLAEGSYRFAEMYGHPEYSMSVK
KLELPAYDPRGAEGHGLGYATNNRGGCHIKNYMISPEILGYPYKMDPHDISDDKIKMLIL
FQDLTALIDAAGLCVFTTFGLGADDYRDMLNAALGWDFSTEDYLKIGERIWNAERLFNLK
AGLVPERDDTLPKRFLEEPMPEGPNKGHIVRLKEMLPRYYKLRGWTEDGRVPKEKAEELG
IAEFL
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atgtacggcaactggggaaggtttctgcgcgtgaacctctccactggagagataaaggtt
gaagagtacgacgaggagctcgccaagaagtggctgggcagcagaggcctggcgatatac
ttccttctgagggacatggacccgaaggtcgacccgcttagccccgagaacaagctgata
attacccccggcccgctgagcggaacgagcgctccaaccggtggaaggtacaacgtcgtc
acgaagagcccgctgacgggctttataaccatggccaactccggcggctactttggtgcc
gagctgaagttcgccggctgggacggaatcatcgtcgaaggaaaggcagagagcccggtc
tacatctatatcaaggacgacaatgtcgagatccgcgacgcgagtcacctctggggcaag
gtcgtgagcgagaccgaagaggccataaagaaagagatagggagcaagaagctccacata
gccagcataggcccggctggagagaacctcgttaagttcgcggccgttatgaacgacggc
cacagggcggctggaagggctggcgttggtgctgtcatgggaagcaagaacctcaaggcg
atagcagtggagggaagcaaacaggttccgatagcggacaggcagaagttcatgctcacc
gtcagggagaagataaacaagctgaggaacgaccccgttgctggtggaggattgccgaag
tacggtaccgccgttctggtcaacataattaacgagaacggtctctatccaacgaggaac
ttccagacgggtgtctttgagcacgcctacgagcagagcggtgaggcgatgactgccaag
tacctcataaagaaccagccgtgctacgcctgtccgataggctgtggaagggtcaacaag
ctcccgaccgttggtgtcactgaagggcctgagtacgagagcatctgggcgctcggagcg
aatttgggcataaacgatttggccagcataatagaggccaaccaccagtgtgatgagttc
ggtctcgacaccatctcgacaggtggaactctggcagctgcgatggagctctatgagaag
ggctacctcacggacgaagagctgggcgacgctccgcccttcaggtggggcaacacggag
gttcttcactactacatcgagaagatagcctacaggaagggcataggcgacaagctcgcc
gagggaagctaccgcttcgccgagatgtatggtcatccagaatactcgatgagcgtcaag
aagcttgagcttccggcatatgacccgcgtggtgcagaaggacacggtctcggttacgca
accaacaaccgtggtggctgtcacatcaagaactacatgataagcccagagatactcggc
tacccgtacaagatggacccgcacgacataagcgacgacaagataaagatgctcatcctc
ttccaggatttgacggccctcatcgacgccgctggactgtgtgtcttcacgaccttcggc
cttggagcagacgactaccgcgacatgctcaacgctgccctcggctgggacttctcaact
gaggactacctcaagattggagagcgcatctggaacgccgagcgcttgttcaacctcaag
gccggactcgttccggagagggacgacaccctgccaaagcgcttcttggaagagccgatg
cccgaggggccgaacaagggtcacattgtccgcctgaaggagatgctcccgcgctactac
aagctccgcggctggacggaggacggaagggttccgaaggagaaggcggaagagctaggc
atagcggagttcctctga

DBGET integrated database retrieval system