KEGG   Taeniopygia guttata (zebra finch): 100219158Help
Entry
100219158         CDS       T01082                                 

Gene name
TGM6
Definition
(RefSeq) protein-glutamine gamma-glutamyltransferase 6
  KO
K05624  
transglutaminase 6 [EC:2.3.2.13]
Organism
tgu  Taeniopygia guttata (zebra finch)
Brite
Enzymes [BR:tgu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     100219158 (TGM6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
LinkDB All DBs
Position
20
AA seq 702 aa AA seqDB search
MSETDLKIGKVNWQSKLNKAAHHTSDYSSTELILRRGQPFNISLNLKTTAQSWDNLTFIA
STGPSPAESQQTKAIFALSEEGANGWSATQEPSEPRCLNFTILSPADAVIGRYKLQLQVL
AGNKVSSKVLGQFVLLFNPWCPDDDVYMADEKERQEYVLNDSGIIFQGLEKDIQEEAWNY
GQFEEDILDISLAVLDRSLNHREDPAVDVSKRNSPVYVSRVISAMVNSNDEKGVVEGKWS
GKFRSGTNPLRWSGSVAILRRWYRARYRPVRYGQCWVFAGVTCTVLRCLGIPTRVITNFN
SAHDKNLNLSVDKYIDVSGNNLHLSEDSVWNFHVWNESWFIRRDLGSFYDGWQVLDATPQ
EKSKGIYQCGPASTRAIKEGDVNLDYDSPFVFAAVNADCVTWIRYSKKRKERIYSDTRKI
GKFISTKAVGTNSRVDVTANYKYPEGSAKERQVYNKALKLLGVRRPGKRSRIPRSRRGFS
RAQPAETPSVSGKLLLDASPVVGQDIPLTLTLRNLTSDFNTIKVKLKASAILYTRRPKAE
ILQLHRSVKLGSEEVKEISFKISYSQYKNSLMDDRKILVTAVCQIKRGASLLVEKDIVLQ
DPFLTIKVLGPAVVHKPVSVEVTFTNPLCDEVTDCVLRAEGSGLLKEQLRIRVERMAPME
TSTVKFEIIPYRSGTRQLQVDLVCTHFSDIKGFVMLQVAPAP
NT seq 2109 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaaacagacctaaaaataggaaaagtgaactggcaatccaaactaaataaagct
gcacaccacacctctgattacagcagcacagaactcatcttgaggagaggacagcccttc
aacatctctctgaacctcaaaacaacagcacaatcttgggacaacctcacctttattgca
agcacaggaccatctccagcggaatcccagcagaccaaggccatatttgccctttctgag
gagggtgccaatggctggagtgcaacccaggagcccagtgagcctcgctgcctgaacttc
accatcctcagcccagccgatgccgtcatcggacgatacaaactccagctccaggtcctt
gctgggaacaaggtctcctccaaagtcctgggccagtttgtgctactcttcaatccctgg
tgtccagatgatgatgtctacatggctgatgaaaaggagcggcaggagtatgtcctgaat
gacagtggaatcatatttcagggattggagaaagatattcaagaagaagcttggaactat
ggacagtttgaagaggacatccttgatatctctctggctgttctggaccggagcctgaac
caccgtgaggacccagctgtggatgtctccaagaggaacagccctgtctatgtgagcagg
gttatcagtgccatggttaacagcaacgatgagaagggagtagtggaagggaagtggagc
gggaagttccgctcaggaacaaaccccctgcgctggagcggcagcgtggccatcctgcgg
aggtggtaccgggcccggtacagacccgtccgctacggccagtgctgggtctttgcagga
gtcacatgcacagtactgagatgcttgggaatacctactcgtgttattacaaacttcaac
tctgcccatgacaagaacctaaatctgagtgttgataagtacattgatgtgtctggaaac
aacctgcacttgagtgaagacagtgtgtggaatttccatgtctggaatgaaagctggttc
attagaagagaccttggctctttttatgatggatggcaggttctggatgcaacaccccag
gaaaaaagcaaaggcatttatcagtgcggtcctgcctccaccagagccattaaggaaggg
gatgtaaacctggattacgacagcccatttgtgtttgcagcagtgaatgctgactgtgtt
acttggattcgctatagcaagaaaagaaaagagagaatttattctgataccaggaagatt
ggaaaatttatcagcaccaaagcagtgggcaccaactcccgtgtggatgtcactgctaat
tacaaatatccagaaggatccgcgaaagaaaggcaggtgtacaacaaagcactgaagctg
cttggtgtgagaagacctgggaaaagaagcagaattccaagatccagaagaggattttca
agggcacagcctgcagaaacccccagtgtctcggggaagctgctccttgatgcatctcct
gtggttggccaggacatcccccttactttgacactcagaaacttgacctcagattttaac
accatcaaggttaaactgaaggcttcagccattctctacaccagaaggcccaaggcagag
attttgcagttgcataggtctgttaaacttggatctgaagaagtgaaagagatttctttc
aagatctcctactcccagtacaaaaactctctgatggatgacaggaagatcctagtgact
gctgtgtgccagatcaaacgaggagcctcacttctagttgagaaggatattgtactccag
gatccttttctcaccatcaaggtccttggtccagctgtggtacacaagcctgtcagtgtg
gaggtgacatttaccaaccctctgtgtgatgaggtgacagactgtgtcctgagagctgaa
ggcagtggcctgctcaaagagcaactccggatccgtgtggaaagaatggcccccatggag
acttcaacagtgaaatttgaaatcattccttacaggagtggcaccaggcagcttcaggtg
gacttggtttgcacccacttttcagacattaagggatttgtgatgcttcaggtggctcct
gctccgtga

DBGET integrated database retrieval system