KEGG   Taeniopygia guttata (zebra finch): 100221396Help
Entry
100221396         CDS       T01082                                 

Gene name
CDC23
Definition
(RefSeq) cell division cycle 23
  KO
K03355  
anaphase-promoting complex subunit 8
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
Cell cycle
Oocyte meiosis
Ubiquitin mediated proteolysis
Progesterone-mediated oocyte maturation
Module
APC/C complex
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100221396 (CDC23)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    100221396 (CDC23)
   04114 Oocyte meiosis
    100221396 (CDC23)
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100221396 (CDC23)
Ubiquitin system [BR:tgu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     100221396 (CDC23)
Chromosome [BR:tgu03036]
 Eukaryotic Type
  Sister chromatid separation proteins
   APC/C complex
    100221396 (CDC23)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
13
AA seq 579 aa AA seqDB search
MAAGGGDFSDLREIKKQLLSVAERSRERGLQHSGKWAAELAFALEPLPLSELPPPPVLTE
EDARDLDAYTLAKSYFDLKEYDRAAYFLQGCKSQKAYFLYMYSRYLSGEKKKDDETVDSL
GPLEKGQVKNEALRELRVELSKKHKAQELDGFGLYLYGVVLRKLDLVKEAIDVFVEAAHV
LPLHWGAWLELCNLITDKEMLKFLSLPDTWMKEFFLAHIYTELQLIEEALQKYQSLIDAG
FSKSTYIISQIAVAYHNIRDIDKALSIFNELRKQDPYRIENMDTFSNLLYVRSMKPELSY
LAHNLCEIDKYRVETCCVIGNYYSLRSQHEKAALYFQRALKLNPRYLGAWTLMGHEYMEM
KNTSAAIQAYRHAIEVNKRDYRAWYGLGQTYEILKMPFYCLYYYRRAHQLRPNDSRMLVA
LGECYEKLNQLVEAKKCYWRAYAVGDVEKMALVKLAKLHEQLNESEQAAQCYIKYIQDIY
SCGEVVEHLEVSTAFRYLAQYYFKCKLWDEASACAQKCCAFNDTREEGKALLRQILQLRN
QGETSSTDVAAPFFLPASLSATNTPTRRVSPLNLSSVTP
NT seq 1740 nt NT seq  +upstreamnt  +downstreamnt
atggcagcgggcggcggtgacttctcggacctgcgggagatcaagaagcagctgctgagc
gtggcggagcggagccgcgagcgcgggctgcagcacagcgggaagtgggctgctgagctg
gccttcgccctggagccactgccactgagtgagctgccacctccgcccgtgctcaccgag
gaggatgctcgtgatctggatgcctacacgttggccaagtcttacttcgatctcaaggaa
tatgacagggctgcctactttttacagggctgcaagagccagaaagcttacttcttgtac
atgtactccagatacctgtcaggggaaaagaaaaaggatgatgagacagttgatagtttg
ggacctctggaaaaaggacaggtgaaaaatgaagctctacgagaattgagagttgagctc
agcaagaaacacaaagcacaggaactggatggatttggcctttatctatatggtgttgtg
ctgcggaaactggacctggtgaaagaagcaatagatgtatttgttgaagctgctcatgtc
ctgcctttgcactggggagcctggctggaactttgcaacttgattacggataaagagatg
ctgaagttcctgtccttgccagatacatggatgaaagagttctttcttgcacacatttat
acagaactacagctgatagaggaagctctgcagaagtatcagtctctcattgatgcagga
ttttccaaaagcacttatatcatctctcagattgcagttgcctaccacaatataagagat
attgacaaagctttatccatttttaatgagctgaggaaacaagatccttacaggatagaa
aacatggacactttctccaacttactgtatgtaaggagcatgaagcctgagttgagctac
ctggctcataatctctgtgagatagacaagtaccgtgttgagacctgctgtgtaattgga
aattattatagcttgcgttcccagcatgaaaaagcagcactctatttccagagggctttg
aaactgaatcctcgttatctaggagcctggacactaatgggacatgagtatatggaaatg
aagaacacgtctgcagctatccaggcttataggcatgcaatagaagtgaacaaaagggac
tacagagcatggtatggcttgggacaaacctatgaaatcctcaaaatgccattttactgt
ctctactactaccgacgggcccaccagctcagaccaaatgattcacgtatgctggttgct
ttaggagaatgctatgagaaactcaatcagttggtggaagctaagaagtgctattggaga
gcttatgctgtgggagatgtggagaaaatggcacttgtgaaacttgccaagttgcatgaa
cagttgaatgaatctgaacaggcagctcaatgctacatcaaatacatccaggatatctat
tcctgtggggaggtagtggagcacctggaggtcagcactgcatttcgttacctggcccag
tactacttcaaatgtaagctttgggatgaagcttcagcatgtgctcagaaatgctgtgcc
ttcaatgatactagagaagaaggaaaggccctgctgcgccagatcttacagcttcgcaac
caaggagaaacatcatccacagatgttgctgctccctttttccttcctgcatccttgtca
gccaccaatactcccacacgtcgtgtctcccctctcaatctgtcttctgtaacaccatga

DBGET integrated database retrieval system