KEGG   Taeniopygia guttata (zebra finch): 100226064Help
Entry
100226064         CDS       T01082                                 

Gene name
PCSK1
Definition
(RefSeq) proprotein convertase subtilisin/kexin type 1
  KO
K01359  proprotein convertase subtilisin/kexin type 1 [EC:3.4.21.93]
Organism
tgu  Taeniopygia guttata (zebra finch)
Brite
Enzymes [BR:tgu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.93  proprotein convertase 1
     100226064 (PCSK1)
Peptidases [BR:tgu01002]
 Serine Peptidases
  Family S8: subtilisin family
   100226064 (PCSK1)
Chaperones and folding catalysts [BR:tgu03110]
 Intramolecular chaperones
  Subtilisin family
   100226064 (PCSK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_S8 P_proprotein Proho_convert S8_pro-domain Peptidase_S8_N
Motif
Other DBs
NCBI-GeneID: 100226064
NCBI-ProteinID: XP_002187974
LinkDB All DBs
Position
Z
AA seq 724 aa AA seqDB search
MVGRRWAGPCASLAVLQAAWSLPRGGSAGRFFLNEWAAEIPAGPDAARAIADELDYDLVG
QIGSLKNHYLFRHKSHPRRSRRSAIHITKRLSDDERVSWAEQQYEKKRTKRAAVRDSAES
FFNDPMWNQQWYLQDTRITPSLPKLDLHVIPVWQKGFTGKGVVITVLDDGLEWNHTDIYA
NYDPKASYDFNDNDHDPFPRYDPTNENKHGTRCAGEIAMQANNRKCGVGVAYNSRVGGIR
MLDGIVTDAIEASSIGFNPEHVDIYSASWGPNDDGKTVEGPGRLAQKAFEYGINQGRNGK
GSIFVWASGNGGRQGDNCDCDGYTDSIYTISISSASQQGLSPWYAEKCSSTLATAYSSGD
YTDQRITSVDLHNECTETHTGTSASAPLAAGIFALALEANPDLTWRDMQHLVVWTSEYDP
LAGNPGWKKNGAGLMVNSRFGFGLLNANALVDLADPKRWKSVPEKRECIVKDKSFEPRLL
RANEEVIIEIPTKACKGQENSIASLEHVQLEATIEYSRRGDLHVTLVSPSGTSTVLLAER
ERDKSPNGFKNWDFMSVHTWGENPAGTWILRITDMHMKQPRVYTSYNAVQNDRRGVEKMT
DLVEDHTTLESLSEKPKATQDTSSSSDKAEDKIPSEAMLHLLQSAFSRQMDQKQPPKKTT
SEKLNIPYEHFYQALKKLNKPSQLRGSEESLYSDYVDLFYNAKPYKHRDDRLLQALVDII
NEGN
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atggtcgggcgtcgctgggccggcccttgcgcgtccctggccgtgctccaggcagcctgg
tccctgccccgaggaggcagcgccgggcggttcttcctcaacgagtgggcagcggagatc
ccggccggccccgacgctgccagagccatcgcggacgagctggactacgacctggtgggg
cagattggatcactgaaaaaccactacttatttagacataagagtcacccaagacggtcc
cgaagaagtgctattcatatcactaagagactttctgatgatgagagggtgtcgtgggca
gagcagcagtatgaaaaaaagcgaactaagcgtgctgccgtgagagactcagcagaaagc
tttttcaacgaccctatgtggaatcagcagtggtatctgcaagatacaagaattactcca
tccctgcccaaactggatctccatgttattcctgtgtggcagaaaggattcacaggcaaa
ggagtcgtcatcacagtcctagacgatggattggagtggaatcacactgacatctatgct
aactatgacccaaaggcaagttatgatttcaatgacaatgatcatgatccctttcctaga
tatgacccaacaaatgaaaacaagcatgggacacggtgtgcaggagaaattgccatgcag
gccaacaacagaaaatgcggagttggggtagcctacaactccagggttggaggtatacga
atgctggatggaatagtcaccgatgctattgaggccagttccatcggtttcaatccagaa
catgtggatatttacagtgcaagctggggccccaacgacgatggtaaaactgtggaggga
cccgggagactggcacagaaggctttcgagtatgggataaaccagggtcgaaatgggaaa
ggctccattttcgtgtgggcttcagggaacggaggtcgtcagggtgacaactgtgactgt
gatggttacactgatagcatctacaccatctccattagcagtgcatctcagcaagggctt
tctccctggtatgcagagaagtgctcttcaactctggccacagcttacagcagcggggat
tatactgaccaaagaattacaagtgttgatcttcacaatgaatgtacagaaactcataca
gggacctctgcatctgcacctctggcagcaggaatttttgctctggcgctggaagcaaac
ccagatctaacgtggagggatatgcagcacttggtagtgtggacctcagaatatgatcca
ctggctggaaatccaggatggaaaaaaaatggagcaggcctgatggtcaacagcagattt
gggtttgggctactcaatgctaatgccttggtggatttagctgatcccaagagatggaaa
agtgtaccagaaaagagagagtgtattgtcaaagacaagagttttgaacccagattatta
agagcaaatgaagaagtcattattgaaattcccaccaaagcctgcaagggtcaagagaac
tccattgcatctctggagcacgtgcagctcgaggcaacgattgaatattcccgtagaggt
gatctccatgtcactctggtttctccatcagggaccagcactgtcttactggctgagaga
gagagagacaaatctcccaatggcttcaagaactgggactttatgtctgtccacacgtgg
ggggaaaatccagcaggcacctggattttaagaattactgatatgcacatgaagcagcca
cgtgtgtatacatcctacaatgctgtgcagaatgacagaagaggagtggagaagatgact
gatcttgtagaggaccataccacactggagagtttaagtgaaaaacccaaggccacacaa
gacaccagcagcagcagtgacaaagcagaagataaaatcccatcagaagccatgctgcat
ttactgcaaagtgcttttagcagacagatggatcagaagcaaccaccaaagaagaccaca
agtgagaagttaaacattccctatgaacacttctatcaagccctcaaaaaattgaacaag
ccctcccagttaagaggctcagaagaaagtctgtacagtgactacgttgatcttttttac
aatgccaaaccttacaagcatagagatgatagactgctgcaagcattggttgatatcata
aatgaaggaaattaa

DBGET integrated database retrieval system