KEGG   Thermococcus guaymasensis: X802_01800Help
Entry
X802_01800        CDS       T04184                                 

Definition
(GenBank) alpha-glucan phosphorylase
  KO
K00688  glycogen phosphorylase [EC:2.4.1.1]
Organism
tgy  Thermococcus guaymasensis
Pathway
tgy00500  Starch and sucrose metabolism
tgy01100  Metabolic pathways
tgy01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tgy00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    X802_01800
Enzymes [BR:tgy01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     X802_01800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phosphorylase DUF3417
Motif
Other DBs
NCBI-ProteinID: AJC71061
UniProt: A0A0X1KIG9
LinkDB All DBs
Position
complement(321872..324370)
Genome map
AA seq 832 aa AA seqDB search
MAKIDTCTQDSIRKKLPYPLGELADLAYNYWWSWNRRASKLWEYIDPEHWREYKNPVKLL
LDTPEKRFKELIKDDDFMNLYELVMDQFHAYMNPRSTWFSTNYPKWDKPIVYLCMEYGIS
KSLPIYSGGLGILAGDHVKTASDLGLPFIAIGLLYKHGYFRQEIDEKGNQIEIFPEYKPE
EMPIKPILDSNGERLLIEVPVEDRIIYARAFEVQVGRVKIYLLDTDVPENSPEDRTICDY
LYNAEIDKRIKQEILLGIGGMRLLKALGIEPGVVHLNEGHPAFANLQRIAWLMEEGLTFT
EALSVVRGTTIFTTHTPVPAGHDRFPIEEVKKRLAKFLEGREELLELGREGDQLNMTLLA
IRTSSYVNGVSKLHAEVSKRMWKDLWPGVPLNEIPIEGITNGVHTMTWVHNEMRKLFDRY
IGKVWREHTNIEGIWYAIERIPDEELWEAHLEAKRQFIELLRRKAMERNRRLGIDDPIPD
IDENALIIGFARRFATYKRATLILSDLERLKKILSNPERPVYIVFGGKAHPRDEGGKEFL
RRVYEVSRMPEFRGKIFVMENYDMGSARLMVAGVDVWLNNPRRPMEASGTSGMKAGLNGV
LNVSIYDGWWVEGYNGKNGWVIGEESTEPENEEDDPKDAQALYDLLEQEVIPTYYNNRER
WIYMMKESIKSIAPRFSTHRMVKEYMDKFYSKAMSNYIWLTRDNYRGAKEIAEWKDRVTA
SWPNVNFVDVKVLDDRSGLEVTVDLDGLKPEDVRVELYYGVRAEGYTVERPHIVELRHPE
KLEDGKWLYTYHGSALRHLGDPCWHYALRIHPHHEKLPHKFLLGLVKWVGLD
NT seq 2499 nt NT seq  +upstreamnt  +downstreamnt
atggccaagatagacacctgcacccaggattcaataaggaaaaagctcccgtacccgctc
ggagagctcgctgacctcgcctacaactattggtggagctggaacaggagggcctcaaag
ctttgggagtacatagaccccgagcactggagggaatacaagaaccccgttaagctcctt
cttgacacgcccgaaaaacgcttcaaggagctcataaaggacgatgacttcatgaacctc
tacgaactcgttatggaccagttccatgcttacatgaacccgcgctccacctggttctcg
acaaactaccccaagtgggacaagcccatagtctatctctgtatggagtacggcataagc
aagagcctgccgatttactctggcggcctgggaatcctcgccggcgaccacgtcaagacc
gcgagcgacctcggccttccgttcatagctattggtcttctctacaagcacggctacttc
cgtcaggagatcgacgagaaaggcaaccagattgaaattttccccgaatacaagccagag
gagatgccgattaagcccatactggacagcaacggcgagaggctcctcatcgaagtcccg
gtagaggataggatcatctacgcgagagcctttgaggtgcaggtcggaagggttaagatt
tacctcctcgataccgatgttcctgagaacagccccgaagacaggacaatatgcgactac
ctctacaatgccgagatagacaagcgcataaagcaggagatactcctcggcatcggcgga
atgaggctcctcaaggccctgggaatagagcccggtgttgtccacctcaacgagggacat
ccggcctttgcaaacctccagaggatagcgtggctcatggaggaaggcctcaccttcaca
gaggccctcagcgtcgtcaggggaacgacaatcttcaccacgcacactccggttccagcc
ggccatgacaggttcccaattgaggaagtcaagaagaggctcgccaagttccttgaggga
agggaagaactcctggagctcggcagggaaggcgaccagctcaacatgacactcctcgca
atcaggacgtccagctacgtaaacggcgtcagcaagcttcatgccgaggtaagcaagcgc
atgtggaaggatctttggcctggtgtgcctctcaatgagatacccatcgagggcataacc
aacggcgttcacaccatgacgtgggtccacaacgagatgaggaagctcttcgaccgctac
atcggcaaggtgtggcgcgagcacacgaacatcgagggcatctggtacgcgattgagaga
attcccgatgaagagctctgggaagcccatcttgaggcgaagagacagtttatagagctc
cttaggagaaaagccatggagaggaacaggcgcctcggaatagacgaccccatcccggac
atcgacgaaaacgccctcataatcggctttgccaggcgcttcgcgacctacaagcgcgcc
acactcattctgagcgaccttgagaggttgaagaaaatcctcagcaaccccgagaggcca
gtctacatagtcttcggcggaaaggcccacccgagggacgagggcggtaaggagttcctc
aggagggtctatgaagtcagcaggatgccggagttcaggggcaagatattcgtcatggag
aactacgacatgggaagcgcaaggctcatggtcgccggtgttgacgtgtggctcaacaac
ccgcgcaggcctatggaagccagcggaacgagcggaatgaaggcaggtttaaacggcgtc
ctgaacgtgagcatctacgacggctggtgggtcgagggatacaacggcaagaacggctgg
gtaatcggtgaggagagcacggagcctgagaatgaggaggacgaccccaaggacgcacag
gccctctacgacctccttgagcaggaagtcattccgacctactacaacaaccgcgagcgc
tggatatacatgatgaaggagagcataaagagcatcgccccgcgcttcagcacccacagg
atggtcaaggagtacatggacaagttctactcaaaggccatgagcaactacatctggctc
acgagggacaactacaggggagcaaaagagatagccgagtggaaggacagggtaaccgca
tcgtggccgaatgttaacttcgttgacgttaaagtccttgacgaccgctcaggccttgag
gttaccgttgacctcgacggtcttaagccggaagacgtccgcgtcgagctgtactacggt
gtccgcgcggagggctacaccgtggaacggccccacatagtcgagctcaggcaccccgag
aagctcgaagacggcaagtggctctacacctaccacggaagcgccctgagacaccttgga
gacccctgctggcactatgccctcagaatacaccctcaccatgagaagctcccgcacaag
ttcctcctaggcctcgtgaagtgggttggccttgactga

DBGET integrated database retrieval system