KEGG   Thermococcus sp. AM4: TAM4_1686Help
Entry
TAM4_1686         CDS       T01638                                 

Definition
(GenBank) Pyruvate kinase
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Organism
tha  Thermococcus sp. AM4
Pathway
tha00010  Glycolysis / Gluconeogenesis
tha00230  Purine metabolism
tha00620  Pyruvate metabolism
tha01100  Metabolic pathways
tha01110  Biosynthesis of secondary metabolites
tha01120  Microbial metabolism in diverse environments
tha01130  Biosynthesis of antibiotics
tha01200  Carbon metabolism
tha01230  Biosynthesis of amino acids
Module
tha_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
tha_M00002  Glycolysis, core module involving three-carbon compounds
tha_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:tha00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TAM4_1686
   00620 Pyruvate metabolism
    TAM4_1686
  Nucleotide metabolism
   00230 Purine metabolism
    TAM4_1686
Enzymes [BR:tha01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     TAM4_1686
Membrane trafficking [BR:tha04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    TAM4_1686
Exosome [BR:tha04147]
 Exosomal proteins
  Proteins found in most exosomes
   TAM4_1686
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PK PK_C HpcH_HpaI IMPDH
Motif
Other DBs
NCBI-ProteinID: EEB74319
UniProt: B7R1M5
LinkDB All DBs
Position
complement(846856..848280)
Genome map
AA seq 474 aa AA seqDB search
MRLPSHKTKIIATIGPASNDRRTIESLIKAGMSVARLNFSHGTFEEHEKVIKRIREASKK
LGRRVAILGDLPGVKIRVGKLLEGKVELRRNQTVTLTVEDVEGMEGIIPVEFKDFPKLVS
PGDTIYLSDGFIVLRVVKVTEKEVICKVVVGGTLYSHKGINVPNARIPLEAVTERDFEIL
EFMIENDVDIAGISFVGSAYDVLKVRHFIKERNARLFVVAKIERPDAVRNFDEILSAADG
VMIARGDLGVEMPIEKLPILQKKLIEKAVMAGKPAIVATQMLESMTTEKLPTRAEVTDVA
NAILDGADAVMLSEETAVGKYPVDAVRMMARIARATEGYRESFGNVRMLEWKEKIPKKGT
IKDAITRSIIEALQVIDARYILTPTRSGYTARLISRFRPKQWILAFTRDEKVANSLMLSY
GVYPFVVESDDEAEILQVIKGLGLAREEDTVLLTKGAPVGKTVGTNTIRIFQVP
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgcgactgccttcccataagacaaagatcatagcaacgatagggcccgcatcgaacgac
agaaggacaatagagagcctgatcaaagcaggaatgagcgttgcgaggctgaacttctcc
cacgggactttcgaggaacatgaaaaggtcataaaaagaattagagaggcctccaagaag
ctcggccgcagggttgcaatactcggtgatctgcccggcgttaagattcgcgtcggcaaa
ctcttagagggcaaggtcgagctgaggcggaaccagacggtgacgctaaccgttgaggac
gtggagggaatggagggcataattccagtggagttcaaggactttccaaagcttgtttcc
ccaggcgatactatctacctcagcgacggtttcattgttctgagggtcgttaaggtcacc
gaaaaggaggttatctgtaaggtagttgtgggagggacgctgtactcccataagggcata
aacgttccaaacgccagaatcccactggaggccgtaaccgagagggacttcgagatactt
gagttcatgatcgagaacgacgttgacattgcaggcataagtttcgtcggttcggcatat
gatgtcctcaaagtcaggcatttcataaaggagcgcaacgcccggcttttcgtcgtggcc
aagatagagcggcccgacgcggttaggaactttgatgagatattgagtgccgccgatggg
gtgatgattgccaggggagacctcggcgttgagatgccgatagagaagctcccaatactt
cagaagaagctcatagaaaaggccgtcatggccggaaagcccgcgatagtggctacgcag
atgctggagagcatgaccacagagaaactgccgacccgtgcagaggttacggacgtcgcc
aacgccatcctggacggcgccgatgcggtgatgctctcggaggaaactgcagtgggcaag
taccccgttgacgccgtgaggatgatggcgaggattgcacgggcgacggaaggctaccgt
gagagctttggcaacgtgaggatgctggagtggaaggagaagataccgaagaagggcacg
ataaaggacgccataacgcggagcataatcgaggcccttcaggtcatagacgcgcgctac
atactgacgcctacaaggagcggctacacggcaaggcttatctcgcgcttccggcccaag
cagtggatcctcgccttcacacgggacgagaaggtcgccaacagtttgatgctcagctac
ggagtttatcccttcgtggtcgagagcgacgacgaggctgagattcttcaggtcataaag
ggcctcggtctggcaagggaagaggacaccgtactgctgaccaaaggcgctccggtgggc
aagaccgtcggcacgaacaccataaggattttccaggtgccgtga

DBGET integrated database retrieval system