KEGG   Thalassospira sp. CSC3H3: CSC3H3_11880Help
Entry
CSC3H3_11880      CDS       T05224                                 

Gene name
alr
Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
thac  Thalassospira sp. CSC3H3
Pathway
thac00473  D-Alanine metabolism
thac01100  Metabolic pathways
thac01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:thac00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    CSC3H3_11880 (alr)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    CSC3H3_11880 (alr)
Enzymes [BR:thac01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     CSC3H3_11880 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:thac01011]
 Precursor biosynthesis
  Racemase
   CSC3H3_11880 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AUG53334
LinkDB All DBs
Position
2606446..2607567
Genome map
AA seq 373 aa AA seqDB search
MSVLPAPGRAADCAQLEINLKAIAENYQRLQKTYTGRTMGAVVKADAYGLGAKAIVPVLK
KQGCRLFFVAHANEAADLFPLLRGGGRIAVFNGLMPGDEEFFIENDVIPVLNDLGQIERW
SNLCREYERPAPAFIHLDTGMNRTGLSPRELQELIERHSQLLYGFEKAGYMTHPVAADEA
DNPITREQYDLFMKWYRRLPPAPRGFCNSSAIFRHKDYHLEFCRPGYALWGGNPTPEKSN
PMRNVVTLTAKVLQLRQIDTGESVGYGASWRAERPSKIATIAAGYADGWLRHLSNVGKLK
IGGIATPMVGRVSMDAFGIDVTDLPEGKLKPGDDVTLLGKDCTVDDIGTMSGTIGYEILT
SLGHRYQRVYTEG
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtccttcccgcccctggccgtgcggcagattgcgcacagctggaaattaacctg
aaagcaatcgctgagaactatcagcgcctgcagaaaacctataccggccgcacaatgggc
gctgtggtgaaggctgatgcatatgggctgggtgccaaggcgattgtgccggttttgaaa
aaacagggctgccgcctgttttttgtggcccatgccaacgaagccgccgacctgttcccg
ttattgcggggtggcgggcgcattgccgtctttaacggcctgatgcccggcgacgaagaa
ttcttcatcgaaaacgacgtgatcccggttctgaacgatctgggccaaatcgaacgctgg
tcgaacctgtgccgcgaatatgaacgcccggcaccggcctttattcaccttgataccggc
atgaaccgcacgggtctgtcgccgcgcgaactgcaggaactgatcgaacgccattcgcag
ttgctatatggtttcgagaaggccggttatatgacccacccggtcgccgccgacgaggcc
gataaccccattacgcgcgaacagtacgacctgttcatgaaatggtatcgccgcctgccc
ccggccccacgcggattttgcaattcgtcggccattttccgccacaaggattaccacctt
gaattttgccggccgggttatgccctgtggggtggcaacccgacaccggaaaaatccaat
ccgatgcgcaatgtggtcacgttaacagccaaggtcctgcaattgcgtcagattgacacc
ggtgagtcggtcggatacggtgcgtcctggcgggccgaacggccatcaaagattgcaacc
attgctgcaggttatgccgatggctggttgcgtcatctttccaatgtcgggaaacttaaa
atcggcggaatcgcaacgcccatggtaggacgtgtttccatggatgcctttggcattgat
gtaaccgaccttcccgaaggcaagctgaaaccgggtgatgacgttaccctgcttggcaaa
gactgcactgttgatgatattggcaccatgtccggtaccatcggctatgaaatcctgacc
tcgcttggtcatcgttatcagcgggtttacaccgaaggctga

DBGET integrated database retrieval system