KEGG   Thermofilum adornatus: N186_01600Help
Entry
N186_01600        CDS       T02802                                 

Definition
(GenBank) alpha-amylase
  KO
K07405  alpha-amylase [EC:3.2.1.1]
Organism
thb  Thermofilum adornatus
Pathway
thb00500  Starch and sucrose metabolism
thb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:thb00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    N186_01600
Enzymes [BR:thb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     N186_01600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_57 Polysacc_deac_1
Motif
Other DBs
NCBI-ProteinID: AGT34716
UniProt: S5ZJN3
LinkDB All DBs
Position
complement(277247..278785)
Genome map
AA seq 512 aa AA seqDB search
MFEVHQPYRLRRNIKSLLLSNLIRKGRLTPEDLEKIYFDEDLNRYVFERVAKRCYLPANY
TIKQQIEYFKDSGKKFKVAYSVSGVLLEQASRWFPELVESFRQLASTGLVEFLDQTYYHS
LAFLVAEEEFIYQVNEHRRLIKKELNYEPRAIENTEFIYNNYVGCLFDRLGYKVVLTEGV
ERILGWRSPNYLYKAKNCNIRVLMRNYRLSDDIGFRFGSTWWNEYPLTAEKYSAWLAATP
GDVILIAIDYETFGEHFPAETGIFEFLRWLPGEILKWENLTISTPTEVAEHLQPRDEIDV
PEHMTISWADLERDLSAWIGNFMQQDAFNRLRDLWLQIKALRNPGYERLWRLLSISDHFY
YMSTKGGGPGDVHSYFSPYKNPYEAHMLFSEAIGDLETRTLLALENDKKALMRYAWMRSL
PDENKFYFYAGPGKPLGKQAWNMFSFIEALREVPPETIVHHQSLQDFANWIEYVVGDVEL
ARKIREINVASPEEIRKQLLSVLENRRAELFG
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgtttgaagttcaccagccgtataggctccgcagaaacattaaatctcttctcctaagc
aacctcataagaaagggaagattgaccccagaagacctagaaaaaatatactttgatgag
gatctaaacaggtatgtttttgagagggttgcgaagagatgctatttgcctgcaaactat
acaataaagcagcagatcgagtacttcaaggactctgggaaaaaattcaaagtagcctat
agcgtgtctggcgtcctcttggagcaggcttctagatggttcccagagcttgttgaaagc
tttagacagcttgcctcgacagggctggttgagttcttagaccaaacatattatcatagt
ttggcttttctagtggcagaagaagagtttatatatcaggtcaacgagcacaggaggctt
atcaagaaagagctaaattacgagcccagagctatagaaaacacagagttcatttacaac
aactatgttggttgcctctttgacaggcttggatacaaagttgtattaacggaaggcgtc
gaaagaatacttggctggaggagccccaattacctatacaaggcaaagaactgcaatata
cgtgtcctaatgaggaactacaggctgtcggacgacataggcttccgctttggctctaca
tggtggaatgagtatccacttaccgctgaaaaatactcggcatggctagcggcgacacct
ggcgacgtcatactaatagccatcgactatgaaacctttggagaacacttccccgccgag
acaggtatatttgagttcctaaggtggcttccaggcgaaatactaaaatgggaaaaccta
actatttcaacgcctacagaggtagcggagcatctacagccgagagacgagatagacgtt
ccagaacacatgacgatttcatgggcagacctcgagagagacctatctgcatggatcggc
aattttatgcaacaggacgcttttaacaggctgagagatctctggctacagataaaggct
ctacgcaaccctggctatgaaaggctttggagactactatctataagcgaccacttctac
tacatgtcaactaaaggcggggggccaggcgacgttcactcctattttagtccatataaa
aacccgtatgaagcccacatgctcttctcagaggctataggagacctcgagacaaggacg
ctcctcgcattggaaaacgataaaaaagcacttatgagatacgcgtggatgcgaagcctc
ccagacgaaaacaagttctacttctatgcgggtccgggaaaacccctaggaaaacaggca
tggaacatgttttcattcattgaggcactacgcgaagtgcccccagaaaccatagttcac
caccagtccctgcaggatttcgcaaactggattgaatatgttgtaggcgacgtagagctt
gccagaaaaattagagaaataaacgtagcaagccccgaggaaattagaaaacagcttcta
agcgtcctcgagaacaggagggccgagctctttggctga

DBGET integrated database retrieval system