KEGG   Thermococcus sp. 4557: GQS_03875Help
Entry
GQS_03875         CDS       T01588                                 

Definition
(GenBank) Anaerobic glycerol-3-phosphate dehydrogenase subunit A, putative (glpA)
  KO
K00111  
glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
the  Thermococcus sp. 4557
Pathway
Glycerophospholipid metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:the00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    GQS_03875
Enzymes [BR:the01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     GQS_03875
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
747605..749092
Genome map
AA seq 495 aa AA seqDB search
MKTKVAIIGAGISGASIARVLSRYENLEVHLIEKAPDVGWGVSKANTALIHGGYDDDPER
YPMRAKLCIRGNRLWHQWVKELEIPHIWNGALIVATKDDDFDELEKLLERGRKNGVPEMR
LVDREELFHLEPNLTPEAIGALWVPIVGQIGPIPAVIAITENAVANGVKTHLETEVTGIK
VENGEVKGVETNNGFIEADIVINAAGLYADRIARMAGIDYFEIHPRKGEYWLFDEGLPGP
RRVLFPTPTPISKGIVVTTEVSGHLMIGPNAQDLPPEEKEDLSTTREGLEEVWEGAKKLW
PQLPPRSKVIRTFAGLRPEPTGGDFIIKAEEEVGGFINVAGIRSPGLTSAPAIAHEVAGI
IERDLGVKLVEKEKWNPYRKEISHLFMMSPEGVNEAVKRNPSYGKVVCRCNNVSEGDVLE
AIERMKFIGVKTPSVDSVKFRTKATTGTCQGSFCRPKIVMLLAREYGVEPWKVTLKGRGS
EIGVGDVKALLRGDA
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacgaaagtggccataataggcgcggggattagtggagccagcatagcgcgcgtc
ctgagcaggtacgagaacctcgaggttcacctgatagagaaggcaccggacgttggctgg
ggcgtcagcaaggcgaacacggctttgatccacggcggttacgatgatgacccggagagg
tacccaatgagggcgaagctgtgcataaggggaaacaggctctggcaccagtgggtcaag
gagctagagattccccacatctggaacggtgctttaatcgtcgcgacgaaggatgatgac
ttcgacgagcttgagaaacttttagagcgcggaaggaagaacggcgtccccgagatgagg
ctcgttgatagggaagaactcttccaccttgagccgaacctgacccccgaagcgataggc
gccctgtgggttccgatagtggggcagattgggccgattccagccgtcatagcgataacc
gagaacgcagtggcgaacggcgtaaaaactcacctcgagacagaggtcaccggcataaag
gtcgagaacggcgaggttaagggagtggagaccaacaacgggttcatagaggctgacatc
gtcatcaacgccgcgggcctctacgccgacaggatagcgagaatggctggcatagactac
ttcgagatacacccgaggaagggagaatactggctcttcgacgagggactccccggaccg
aggagggttctcttcccgaccccgaccccgataagcaagggaatcgtggtaacaaccgag
gtatccggccatctgatgatagggccgaacgcccaggatctgccgcccgaggagaaagag
gacctttccaccacaagggaagggctcgaggaagtctgggaaggggcaaagaagctctgg
ccccagcttccgccgaggagcaaggtcatcagaaccttcgccggattgaggccagaaccg
acgggaggggacttcataatcaaagccgaggaagaggtcgggggcttcatcaacgtcgcc
ggaatacgctctccgggactcacaagcgcccctgccatagcccacgaggttgccgggata
atcgaacgcgacctcggggtaaagctggtcgagaaagagaagtggaacccctacaggaag
gagataagccacctcttcatgatgagtcccgagggggtgaacgaggccgtaaagaggaac
ccctcttacggaaaggtggtctgcaggtgcaacaacgtgagcgagggggacgtgcttgaa
gccattgagaggatgaagttcataggcgttaaaacgccgagcgtggattccgtgaagttc
aggacgaaggcaaccaccgggacatgccaggggagcttctgcaggccgaagatagtcatg
ctcctcgcgagggagtacggagttgagccgtggaaggttaccctgaaaggtaggggaagc
gagattggagtgggcgacgtcaaggcccttctcaggggggatgcctga

DBGET integrated database retrieval system