KEGG   Thermofilum uzonense: MA03_01005Help
Entry
MA03_01005        CDS       T03924                                 

Definition
(GenBank) aldehyde:ferredoxin oxidoreductase
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
thf  Thermofilum uzonense
Pathway
thf00030  Pentose phosphate pathway
thf01100  Metabolic pathways
thf01120  Microbial metabolism in diverse environments
thf01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:thf00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    MA03_01005
Enzymes [BR:thf01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     MA03_01005
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_C AFOR_N
Motif
Other DBs
NCBI-ProteinID: AKG39278
UniProt: A0A0F7FJP7
LinkDB All DBs
Position
complement(179693..181528)
Genome map
AA seq 611 aa AA seqDB search
MKGWNGRILWIDLSNRKIKIHEYDGSFAQKYIGGRGFAARILWDYLPPGLDPFSPHNLLV
IATGPITGLPGPSTGKLVVAAKSPLTHGYGDGNIGSLGAVYMRYAGYDALVVTGKSEKPV
YLHIYDGKVEFSPAEDLWGRDTFTSERILRKKHGRNTGILLIGPAGENKVKLATVMSQEG
RSGGRPGIGAVMGSKNLKAIVFSGDRLPELHDPEEYKKLAAEAYAEIKKKPAYSFWMRQG
TMSTIQWSQANGVLPTYNFSEGVFEFSENIDGNAMERMKKGQRGCPNCNMPCGNYILDDT
GEISELDYENVAMLGSNIGLNDLAKIARLNRLADMWGIDTIGLGAALGFAAEASQSKIIE
EKIDFGDFNSMLELSEDIVYRRGLGDLLAEGLEHASLKLGGDEIAVHVKGLSVSAYDCHA
APAMALSYGVSTVGAHHKDAWVISWEVAHGRFEYTRQKAFRVFELQRIRGGVFEMLVSCR
LPWVEVSLELDWYVRLFNLATGLSWTWDDFLIAAERVLTLIRAFWVREFQAEGKGWHRGR
DYPPKKWFTRPLTKGPFKGARLDIDRYDEMLGAYYSYVGWDHRGIPRASTLERLGLTDVC
KDLESFIQLTY
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
ctgaaaggatggaatgggaggatattatggattgacttatccaataggaagatcaagata
catgaatacgatggctcattcgcccaaaaatacataggtgggagaggatttgctgcacgt
atattgtgggattaccttcccccaggactagatcctttctcaccacacaacttgcttgtg
atagcaacagggcctataacaggtcttcccggcccaagcactggaaaactcgtcgttgca
gctaagagtccactcacacacggttacggagacggaaatattgggagcttgggagccgtt
tatatgagatacgctggttacgatgctctagtggtaacagggaaatccgagaaacctgtc
tacttacacatttacgatgggaaagtcgagtttagtccggctgaagacctctggggcaga
gatacatttaccagcgagaggatactccgaaagaaacatgggagaaacacaggtatactt
ctcattgggccggctggcgaaaataaggtaaagctcgctacggttatgtcacaggagggt
aggagcggtggtaggccaggcataggagcggttatgggtagcaaaaacttgaaagctata
gtgttttcaggagatagacttcctgagctccacgatccagaggagtataaaaagctagca
gccgaggcatatgcagagattaagaagaagccggcttattctttctggatgagacaggga
accatgtcaacaatacaatggtcgcaggctaacggcgtactaccaacctataatttcagt
gagggtgtcttcgagtttagcgagaatatcgacgggaatgcaatggagcggatgaagaaa
gggcagcgaggatgccctaactgcaacatgccctgcggaaattatattctagatgatact
ggagagatctctgaacttgactacgagaatgtagccatgctcggttccaacataggtctt
aatgacctggccaagatcgcaaggcttaacaggcttgccgacatgtggggaattgatact
attggccttggtgccgctctgggttttgcagcggaggcctctcaaagcaaaatcatagag
gagaagattgatttcggagactttaactcgatgcttgaattatccgaggatatcgtttat
cggcggggcctgggcgacctgcttgcagagggcttagagcacgcctcactcaagcttgga
ggggatgaaattgctgtccacgttaagggacttagtgtttctgcttatgactgccacgcc
gcaccggccatggcactatcatatggtgtaagcacagtgggagcccatcataaagacgca
tgggttatatcatgggaagtagcacacggaaggttcgagtatacacgtcaaaaagcgttc
agggtattcgagcttcaaagaataagaggtggggtttttgaaatgctggtatcatgtagg
ttgccctgggttgaggtaagtctagagttggactggtatgtaaggctgtttaacctcgct
acggggctatcctggacttgggacgattttctgatagctgctgagagagtattaacttta
atccgagctttctgggtgagagagttccaagctgaaggtaaaggttggcatagaggcagg
gactatccacctaagaaatggtttacacgtccgctaacaaaagggccattcaagggagca
agactggacatagatagatacgacgaaatgctgggtgcctactactcgtatgttgggtgg
gatcacagaggcattcctagagcgtccacgcttgaaaggctaggattaacggacgtatgc
aaggatttagaaagttttatacagctaacttactga

DBGET integrated database retrieval system