KEGG   Thermogladius calderae: TCELL_0002Help
Entry
TCELL_0002        CDS       T02127                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
thg  Thermogladius calderae
Pathway
thg03030  DNA replication
thg03410  Base excision repair
thg03420  Nucleotide excision repair
thg03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:thg00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    TCELL_0002
   03410 Base excision repair
    TCELL_0002
   03420 Nucleotide excision repair
    TCELL_0002
   03430 Mismatch repair
    TCELL_0002
Enzymes [BR:thg01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     TCELL_0002
    6.5.1.6  DNA ligase (ATP or NAD+)
     TCELL_0002
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     TCELL_0002
DNA replication proteins [BR:thg03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    TCELL_0002
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     TCELL_0002
DNA repair and recombination proteins [BR:thg03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     TCELL_0002
   NER (nucleotide excision repair)
    Other NER factors
     TCELL_0002
   MMR (mismatch exicision repair)
    Other MMR factors
     TCELL_0002
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C DNA_ligase_OB_2
Motif
Other DBs
NCBI-ProteinID: AFK50427
UniProt: I3TCD9
LinkDB All DBs
Position
complement(249..2051)
Genome map
AA seq 600 aa AA seqDB search
MLADTFESLESITARTQMVNILVALLKKTPAEIIDRVVYIIEERLWPDWKGLPELGVAEK
SIIRAIAVATGQSDDVVERTAKTLGDLGKAAESLISTVREKQKRTTSLLSFVTSRRELTV
SRVYDTFVRIAMAQGEGSKDIKIRLLSGLLAEASPKEARYIVRFAEGKLRLGVGEATLMD
ALAVAFGGGSFARPIIERAYNLRADLGEVARVVATKGIEELKALKPVVGIPIRPMLAERH
NNPKEILEKVGGVGFVEYKYDGERAQIHKKGDEVVIFSRRLENITHQYPDVVDYVKRGVK
AEEAIVEGEIVAIDPDTGEFKPFQELMHRKRKHDVMSVVKEIPVRVYLFDLLYLNGVDYT
VKPLPERRKALEEVIEKNEGLDIAEYITAKNPVELEKFFMGAISDGAEGVMVKAIHKDSI
YQAGTRGWLWIKFKRDYRSEMIDTVDLVVVGAFYGRGRRGGKFGALLMAAYNEEKDVFET
VCKVGSGFTDEDLNQLPDLLKPYIVDKKPARVVSNIQPDVWVVPKLVAEIIGAELTLSPL
HTCAVGKVRGDAGISIRFPRFIRWRDDKSPEDATTSNELFEMYKNQLKKIAEKPGEGEAT
NT seq 1803 nt NT seq  +upstreamnt  +downstreamnt
gtgcttgcagacacttttgagtctctagagagcattactgccaggactcagatggtcaat
atcctggtcgcccttttgaagaagacgcccgctgagatcatcgaccgggtcgtgtacata
atcgaggagaggttgtggcccgactggaagggcctgcccgagctgggggtagccgagaag
tcgatcatcagggctattgctgtagcgacgggtcagagcgacgacgtagtagagaggact
gcgaagactttaggcgacctaggcaaagccgctgagtccctgatctcaactgtgagagaa
aagcagaagagaaccacttcgctactgtctttcgtgacttctaggagagagctaacggtg
tctagggtctacgacacgtttgtcaggatcgcaatggcgcagggcgaaggaagtaaagac
attaagattaggcttttgtccggcttgttagcggaggcgtctcctaaggaagcgaggtac
atagtcaggttcgccgaggggaagcttaggcttggtgtaggcgaggcaactttaatggac
gccctggcggtggccttcgggggaggctcctttgcgaggcctattattgaaagggcatac
aacctccgggcagacttaggcgaagtcgcgagagtagtagcaacgaagggcatcgaggaa
ctgaaggctcttaaaccagtggtaggaataccgattaggcccatgctcgccgagaggcac
aacaaccccaaggagatactggagaaggtaggtggtgtaggctttgtcgagtacaagtac
gacggggagagggcacaaatacacaagaaaggagacgaggtagtcatattctcgagaagg
ctggagaacatcactcaccagtaccccgacgttgtggactacgtcaaaagaggtgttaag
gcggaagaggccatagtcgagggcgagatcgtcgcaatagacccagatacaggcgagttc
aaaccgttccaggagctaatgcacaggaagaggaagcacgacgtaatgtccgtggtgaag
gagatccccgttagggtctatttgttcgacttactctacctcaacggcgttgactacact
gttaaaccgttgcccgagaggagaaaggctctagaagaagttatcgagaagaatgagggt
cttgacatagcagagtacatcacagcgaagaacccagtcgagttagagaagttcttcatg
ggggctataagcgacggtgcggagggggtgatggtcaaagcaatccacaaggactcgatc
taccaggctggtacacgtggttggctttggatcaagttcaagagggactacaggagcgag
atgatagacacggtagaccttgtagtagtcggggctttctacggcaggggccgtaggggc
ggtaaattcggtgccctgctcatggcagcgtacaacgaggagaaggacgtcttcgagacc
gtctgcaaagtggggagtggcttcacagacgaggatctgaaccagctacccgacctacta
aagccctacattgtggacaaaaagccggcgcgagtggtatctaacatccagccagacgtc
tgggttgtaccgaagttggtcgccgagataataggtgcagagctaaccctttcaccactc
cacacttgtgcggtgggcaaggttaggggtgatgccggtatctctataaggttcccacgc
tttatcaggtggagagacgacaagagccccgaggacgctactacttcaaacgagctcttc
gagatgtacaagaaccagttaaagaagatcgccgagaagcccggggaaggagaagctact
taa

DBGET integrated database retrieval system