KEGG   Thermococcus sp. 5-4: CDI07_05580Help
Entry
CDI07_05580       CDS       T05088                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
thh  Thermococcus sp. 5-4
Pathway
Pyruvate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:thh00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    CDI07_05580
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    CDI07_05580
   00680 Methane metabolism
    CDI07_05580
Enzymes [BR:thh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     CDI07_05580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(1010728..1012152)
Genome map
AA seq 474 aa AA seqDB search
MIPRTMSTQHPDNVFIPFFAGSPTMGGEDEIVEAFYAFSVLGIDEQMWDFEGKEVDEFVV
KKLFERYGYFFKRKKLGEELRLTPRVPNPSVEKAEAKLLLETLEAIPRSADYARLFYGEE
LPPIFEVILPMTTSSQELNRVYELYRHYIAGKQYKRVHDIKLHEWIGEFYPSEIGVIPLF
ESREAILGAADIVREYLGGKEVEYQRVFLARSDPAMNYGIISAVLYDKLALFELQGLEEE
LGIPIYPIIGVGGAPFRGHFTPENVEGVLAEYPSVQTFTIQSSFKYDRTPKDVIRAVERI
RESKRRKAQPVPEEAFEIIKKYEGRYSEELRALAPFIREVAKFVPSRRRRKLHIGLFGYS
REVNGSALPRAIKFTASLYSLGIPPELLGLSALSEKELEFLGDYYLGLYRDIEFAFRYFN
PEAAERFPFLKPLAEMAKEYEQDERHGEITSRILTGELSSELIVEAAGIRGFLG
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgataccaagaacgatgagcactcagcatcctgacaacgtattcattccctttttcgca
ggcagtccgacgatgggcggtgaggacgagatcgtcgaggctttctacgccttcagcgtc
ctggggatagacgagcagatgtgggactttgagggcaaagaagtggacgaattcgtcgtc
aagaagctattcgagcgctatggctatttcttcaagcgtaaaaagctcggggaagaactc
agactgacgccgcgcgtccccaaccccagcgtcgaaaaggccgaggcgaaactcctcctt
gagaccctagaagccataccccgctcggcggactacgcgaggttgttctacggtgaagag
cttccgccgatatttgaggtcatcctcccgatgacaacctcttcccaggaactgaacagg
gtttacgagctctacaggcactacatagccggaaagcagtacaagcgggtccacgacatc
aagctccacgagtggataggggagttctacccctcagagataggcgtcatcccgctcttc
gagagcagggaggcgatactgggcgcggcggacatcgtgcgggagtacctcggcgggaaa
gaggttgaatatcagcgcgtttttctcgcgaggagcgaccccgcgatgaactacggcatc
ataagcgcggtgctctacgacaagctggcgctcttcgaacttcagggactcgaggaggaa
ctcggaattccaatctatccgataatcggcgtcggcggtgcgccgttcagggggcacttc
acccccgagaacgtcgagggggttctggcagaatacccgagcgtccagaccttcacgata
cagagttcgttcaagtacgacaggacgccgaaggacgtcataagggccgttgagcggatc
agggaatcgaagaggagaaaagcccagcccgttccggaggaggcgtttgaaatcatcaag
aagtacgagggcagatactcggaggagctcagggcgctcgctcccttcatcagggaggtc
gcaaagttcgtcccatcgaggagacgaaggaagctccacatcggtctcttcggctactct
cgcgaggtgaacggctcggcgctgccgagggcgataaagttcacggcctcgctctactcc
ctcggaattcccccggagctcctcggcctgagtgcgcttagtgaaaaggagcttgaattc
cttggcgactactacctgggcctttatcgggacatcgagttcgccttccgttacttcaac
cccgaggctgccgagagattcccgttccttaaaccgctcgcggagatggcgaaagagtac
gagcaggacgagaggcacggcgagataacctcaaggatactaaccggggagctgagcagc
gagctgatagttgaagcggcggggattagggggtttttgggataa

DBGET integrated database retrieval system