KEGG   Thauera sp. K11: CCZ27_12120Help
Entry
CCZ27_12120       CDS       T05106                                 

Definition
(GenBank) superoxide dismutase [Fe]
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
thk  Thauera sp. K11
Brite
Enzymes [BR:thk01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     CCZ27_12120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ATE60588
UniProt: A0A290ZNL1
LinkDB All DBs
Position
2799796..2800380
Genome map
AA seq 194 aa AA seqDB search
MEHTLPPLPYAKDALAPHISAETLEFHYGKHHQAYITNLNNLIKGTEYENLDLEAIIKKA
PAGGVYNNSAQVWNHTFFWNSLTPNGGGEPGGALADAIKAKWGSFDDFKKAFQASAVGNF
GSGWTWLVKKADGSVDIVNMGAAGTPLTTGDKALLCIDVWEHAYYIDYRNRRPDFVATFL
DKLANWDFAAKNFA
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atggaacacacccttccgcccctgccctacgccaaggatgccctggcgccgcacatttcc
gccgaaacgctcgagttccactacggcaagcaccatcaagcctacatcaccaacctgaac
aacctgatcaagggcaccgagtacgagaacctcgacctcgaagccatcatcaagaaggcc
ccggccggcggcgtctacaacaactccgcccaggtctggaaccacaccttcttctggaac
agcctgacgccgaacggcggcggcgagcccggcggcgcgctggccgatgcgatcaaggcc
aagtggggctcgttcgacgacttcaagaaggctttccaggcttcggccgtgggcaacttc
ggttccggctggacgtggctggtcaagaaggccgacggctcggtcgatatcgtcaacatg
ggcgccgccggcaccccgctgacgaccggcgacaaggccctgctctgtatcgacgtgtgg
gaacacgcctactacatcgactaccgcaaccgccgtccggacttcgtcgcgaccttcctc
gacaagctggccaactgggatttcgccgcgaagaacttcgcctga

DBGET integrated database retrieval system