KEGG   Thauera sp. K11: CCZ27_13880Help
Entry
CCZ27_13880       CDS       T05106                                 

Definition
(GenBank) ribulose bisphosphate carboxylase small subunit
  KO
K01602  
ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
thk  Thauera sp. K11
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:thk00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    CCZ27_13880
Enzymes [BR:thk01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     CCZ27_13880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
3180700..3181125
Genome map
AA seq 141 aa AA seqDB search
MRITQGCFSYLPDLTDAQIAAQVDYCLRQGWAVSLEYTDDPHPRNTYWAMWGLPMFDLRD
PAGAMAELGACREANPETYIRINAFDPTRGWETVRMSFIVQRPAAEPGFRLVRQETKGRS
LHYTMESYAVDRSPEGARYNR
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atgcgcatcacccaaggctgcttttcctacctgcccgacctcaccgacgcgcagatcgcc
gcccaggtcgactattgcctccgccagggctgggcggtgtcgctcgaatacaccgacgac
ccgcacccgcgcaacacctactgggccatgtggggcctgccgatgttcgacctgcgcgac
cccgccggcgcgatggccgaactcggggcctgccgcgaagccaaccccgaaacctacatc
cgcatcaacgccttcgatccgacccgcggctgggagacggtgcgcatgtccttcatcgtc
cagcgccccgccgccgaaccgggcttccgcctcgtccgccaggaaacgaagggccgcagc
ctgcactacacgatggaaagctacgcggtagaccgaagccccgaaggcgcccgctacaac
cgctag

DBGET integrated database retrieval system