KEGG   Thauera sp. K11: CCZ27_16495Help
Entry
CCZ27_16495       CDS       T05106                                 

Definition
(GenBank) acyl-phosphate glycerol 3-phosphate acyltransferase
Organism
thk  Thauera sp. K11
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(3788359..3791151)
Genome map
AA seq 930 aa AA seqDB search
MSTPQGGAVEAEVLRIVGELVGELRAGRPAAAALDSHLERDLGLDSLARVELLARLERSA
GVRLPPDTLAAAETPRQLAQALHDAHPDIAAAVPEPVAAAPAREHVEAPAAATLVEVLQW
HAQHWRQRVHVRLLHDDAEVAALSYGALLDSGLQMAAGLRRTGLQPGDAVAIMLPTGLEF
FAGFFGALLAGGVPVPMYPPTRPSQLEDHLRRQAGILASCGAPVLLTVAEARLAAGVLRA
QTPTLRHVVTPPELQEDGAAGTAAPASAGGLALLQYTSGSTGNPKGVMLTHANLLANIRA
WSGAIALAPGDVCVSWLPLYHDMGLIGTWLGSLYNGNPLVLMPPLDFLSRPVNWLRAIHR
YRGTITAAPNFAFELVVRHAARAELAGLDLSCWRLAINGAEPVSPDTMERFCAHLAPAGF
RREAMTPLYGLAENAVGLTVPAPGRGPLIDRVRRDTFLRRALAVPAADVGDADAIRFVGC
GRPLPGHALRVVDAGGTPLPERQVGRIEFQGPSATAGYYRNPEETARLFDGDWLDTGDLG
YLAGGELFVTGRVKDMIIRGGRNLYPYELEEAIGALPGVRRGCVAVFGALDRATAGERLV
AVVETREDADEARRTLVRAVEDLALERLGLPLDEVVLAPPHSVLKTSSGKIRRAATRDLY
LAGALGSRRGVRMQMLRLAAAGLAAQGRHLLARCGALSWAGWAWAMLLVLAPPVWLAVVA
LRRPARGWRIARHGARAYARLIGVPVEVEGTVNLPPQVPCVVAANHASYVDGLVAVAALA
RPFTFVAKRELGEHPIAGPFLRGLGAAFVERFSLADSVGAARELGERARAGESLFFFPEG
TFVRRAGLREFRLGAFLTAAEAGLEVVPLAIRGTRAVLPDETWMPRRAAITVHLDEPLAA
SGRTWQAAVALRDAVRARILARCGEPDLAG
NT seq 2793 nt NT seq  +upstreamnt  +downstreamnt
atgagcacgccgcagggcggggcggtcgaggccgaggtgctgcgcatcgtcggcgaactc
gtcggcgagctgcgcgccggacggccggccgcggcggcgctggacagccacctcgagcgc
gacctgggcctggacagcctggcgcgggtggagcttctcgcccgcctcgaacgcagcgcc
ggcgtcaggctgccgcccgacacgctggccgccgccgagacgccgcgccagttggcgcag
gcgctgcacgacgcgcatccggacatcgccgcggccgtccccgaacccgtcgcggcggcg
ccggcccgagagcacgtcgaggcgccggcggcggccacgctcgtcgaggtgctgcaatgg
catgcgcagcactggcggcagcgtgtccatgtgcgcctgctgcatgacgatgccgaggtg
gcggcgctcagctacggtgccctgctcgactccggcctgcagatggcggcgggcctgcgg
cgcaccgggctgcagcccggcgacgcggtggcgatcatgctgccgaccgggctcgagttc
ttcgccggcttcttcggcgcgctgctggcgggcggcgtaccggtgccgatgtacccgccg
acgcggccgtcgcaactggaggaccatctgcgccgccaggccggcatcctggccagttgc
ggcgccccggtcctgctcacggtggcggaggcgcgcctggcggccggcgtgctgcgcgcg
cagacgccgacgctgcgccacgtcgtcacgccgccggaactgcaggaggatggcgctgcg
gggacggccgcgccggcatcggcaggcggactcgcgctgctgcaatacacctcgggcagc
accggcaaccccaagggcgtgatgctgacccacgccaacctgctcgccaacatccgcgcc
tggagcggcgcgatcgcgctcgctcccggggacgtgtgcgtgagctggctgccgctgtac
cacgacatgggcctcatcgggacctggctcggcagcctgtacaacggcaatcccctggtg
ctgatgccgccgctggatttcctgtcgcgtccggtcaactggctgcgcgcgatccaccgt
taccgcggcaccatcaccgcggcgccgaacttcgctttcgaactggtggtgcgccatgcc
gcccgggccgaactcgcggggctggacctgtcgtgctggcggctggcgatcaacggcgcg
gaaccggtgagcccggacacgatggagcgcttttgcgcgcacctcgccccggccggtttc
aggcgcgaggcgatgacgccgctctacggcctggccgagaacgcggtcgggctcacggtg
cccgcccccggccgcggccccctcatcgacagggtgcggcgcgacaccttcctgcgccgc
gcgctggcggtgcccgcggcggacgtcggcgatgcggacgcgatccgtttcgtcggctgc
gggcggccgctgcccgggcacgcgctgcgcgtggtggatgccggcgggacgccgctgccg
gagcggcaggtggggcgcatcgaattccaggggccctcggccaccgccgggtactaccgc
aacccggaggagaccgcgcgcctcttcgacggcgactggctcgacaccggcgacctcggc
tacctcgccggcggcgagctgttcgtcaccggccgcgtcaaggacatgatcatccgcggc
gggcgcaacctctatccctacgaactggaggaggcgatcggtgcgctgcccggcgtgcgc
cgcggctgcgtcgcggtgttcggcgcgctcgaccgggcgacggcgggcgagcgcctggtc
gcggtggtcgagacgcgcgaggacgcggacgaggcgcgccgcacgctggtgcgcgccgtc
gaggacctggcgctggaacgcctcggcctgccgctcgacgaggtcgtgctggcaccgccg
cacagcgtgctgaagacgtccagcggcaagatccgccgcgccgcgacgcgcgatctctac
ctcgccggcgcgctgggcagtcgccgcggcgtgcgcatgcagatgctgcgccttgccgcc
gcgggcctggccgcgcagggccggcacctgctggcgcgctgcggtgcgctgtcgtgggcc
ggctgggcatgggcgatgctgctggtgctggcgccgccggtgtggctggcggtggtggca
ctgcgccgtcccgcgcggggctggcgcatcgcccggcacggggcgcgggcctatgcgcgg
ctgatcggcgtgccggtcgaggtggaaggcacggtcaacctgccgccgcaggtgccgtgc
gtggtggcggccaaccatgcgagctatgtcgatggcctggtggcggtcgcggcgctggcg
cggcccttcaccttcgtcgccaagcgcgagctgggcgagcatccgatcgccggccccttc
ctgcgcggcctcggcgccgccttcgtggagcgcttctccctggccgacagcgtcggggcc
gcgcgcgaacttggcgaacgtgcccgcgccggggagtcgctgttcttcttcccggagggg
accttcgtccgccgcgccgggctgcgcgagtttcgcctcggcgccttcctgacagccgcg
gaggccggcctcgaggtggtgccgctggcgatccgcggcacgcgcgcggtgctgcccgac
gaaacctggatgccgcggcgggcggcgatcaccgtgcatctggacgaaccgctggcagcc
tcggggcgcacctggcaggcggccgttgccctgcgggatgcggtgcgcgcccggatactc
gcccgctgcggcgaaccggatctggccggctga

DBGET integrated database retrieval system