KEGG   Thermococcus cleftensis: CL1_1487Help
Entry
CL1_1487          CDS       T02169                                 

Definition
(GenBank) ribulose bisophosphate carboxylase
  KO
K01601  
ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
thm  Thermococcus cleftensis
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:thm00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    CL1_1487
Enzymes [BR:thm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     CL1_1487
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1431424..1432758
Genome map
AA seq 444 aa AA seqDB search
MVEKFDRIYDYYVDKDYEPNRKRDIIAVFRITPAEGYSIEAVAGGVAAESSTGTWTTLYN
WYEEERWADLSAKAFDFHDMGDGSWIVKIAYPFHAFEEANLPGLLASIAGNVFGMKRAKA
LRLEDLYFPEKLIREFDGPAFGIEGVRKMLDIKDRPIYGVVPKPKVGYSPEEFEKLAYDL
LSNGADYMKDDENLTSPWYNRFEERAEIIARIIDRVENETGEKKTWFANITANLPEMEER
IEILADLGLKHAMVDVVITGWGALQYIRDLAADYGLAIHGHRAMHAAFTRNPYHGISMFV
LAKLYRLIGIDQLHVGTAGAGKLEGGKWDVIQNARVLREETYRPDEGDVFHLEQKFYGIK
AAFPTSSGGLHPGNLPPVIEALGTDIVLQLGGGTLGHPDGPAAGARAVRQAIDAIMQGIP
LDEYAKTHKELARALEKWGHVTPV
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atggtggagaagttcgacaggatatacgactactatgtggacaaggactacgagcccaac
aggaagagggacataatagccgtcttccgcataacccccgctgagggatactctatagag
gcagttgccggtggtgtcgccgccgagagctcgaccggaacctggacgaccctctacaac
tggtacgaagaggagcgctgggcggacctctcggctaaagccttcgacttccacgacatg
ggcgacggaagctggatagtcaagatcgcctatcccttccacgccttcgaggaggccaac
cttcccggacttctcgcgagcatagcggggaacgtcttcggaatgaagcgcgccaaggcc
ctgcgccttgaggacctctacttcccggagaagctcatcagggagtttgacgggccggcc
ttcggtatcgagggcgtcaggaagatgctcgacatcaaggacaggcccatctacggcgtt
gttccaaagcccaaggtcggctattcgcccgaggagttcgagaagctcgcctacgacctg
ctctccaacggtgccgactacatgaaggacgacgagaacctcaccagcccctggtacaac
cgctttgaggagagggccgagatcatcgcgaggataattgacagggttgagaacgagacc
ggtgagaagaagacctggttcgcgaacataaccgccaacctccccgagatggaagagagg
atcgagattctagcggaccttggcctcaagcacgccatggttgacgtcgtcataaccggc
tggggagcgctgcagtacatcagggacctcgcggccgactacgggctggccattcacggc
cacagggcgatgcacgcggccttcacgaggaacccctaccacggcatctcgatgttcgtc
ctggcgaagctttacaggctcataggcattgaccagctccacgtcggaaccgccggagcc
ggcaagctcgagggcggaaagtgggacgtcatccagaacgcgagggtcctcagggaggaa
acctacaggccggacgagggcgatgtcttccacctcgagcagaagttctacggcataaag
gcggcgttcccgaccagctccggtggactccaccccggcaacctgccgcccgtcatagag
gcccttggaaccgacatagtgcttcagctcggcggtggaacactcggccacccggacgga
cctgccgcgggggcaagggccgtcaggcaggccatagacgccataatgcagggaatcccg
ctcgacgagtacgccaagacccacaaggagctcgccagggctctggagaagtggggccac
gttaccccggtctga

DBGET integrated database retrieval system