KEGG   Thermosynechococcus sp. NK55: NK55_06230Help
Entry
NK55_06230        CDS       T02977                                 

Gene name
pepC
Definition
(GenBank) phosphoenolpyruvate carboxylase PepC
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
thn  Thermosynechococcus sp. NK55
Pathway
thn00620  Pyruvate metabolism
thn00680  Methane metabolism
thn00710  Carbon fixation in photosynthetic organisms
thn01100  Metabolic pathways
thn01120  Microbial metabolism in diverse environments
thn01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:thn00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    NK55_06230 (pepC)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    NK55_06230 (pepC)
   00680 Methane metabolism
    NK55_06230 (pepC)
Enzymes [BR:thn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     NK55_06230 (pepC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AHB88551
UniProt: V5V5B1
LinkDB All DBs
Position
complement(1322173..1325208)
Genome map
AA seq 1011 aa AA seqDB search
MTSVLDATNRDRLIESESLAARTLQERLRLVEEVLVDVLAAESGQELVDLLRRLGALSSP
EGHVLHAPEGELLKVIESLELNQAIRAARAFNLYFQIINIVEQHYEQQYNRERAAQERLR
RRSVMSEPISGVSGEGFPLPHNAANATAVRSGPSERLEHSLYEAIPATQQYGSFAWLFPR
LQMLNVPPRHIQKLLDQLDIKLVFTAHPTEIVRQTIRDKQRRVARLLEQLDVLEGASAHL
TDWNAQTLRAQLMEEIRLWWRTDELHQFKPEVLDEVEYTLHYFKEVIFAVIPKLYRRLEQ
SLHETFPTLEPPRHNFCRFGSWVGGDRDGNPYVKPEVTWQTACYQRNLVLEEYIKSVERL
INLLSLSLHWCDVLPDLLDSLEQDQRQLPSIYDQYAVRYRQEPYRLKLAYVLKRLQNTRD
RNRALQTYCIRRHEAEELNNGQFYCHGEEFLAELLLIQRNLKETGLACRELDDLICQVQV
FGFNLAALDIRQESTCHAEALNEITAYLGILPCPYTELSETERTRWLLSELSTRRPLIPG
ELPFSDRTNEIIETFRMVRQLQQEFGTDLCNTYIISMSHEVSDLLEVLLFAKEAGLFDPA
TGASTLQAIPLFETVEDLKHAPAVLTQLFSLPFCRSYLGSNSTPFLQEVMLGYSDSNKDS
GFLSSNWEIYKAQQQLQKIAENFGFQLRIFHGRGGSVGRGGGPAYAAILAQPAQTIKGRI
KITEQGEVLASKYSLPELALFNLETVATAVIQASLLRSSIDEIEPWHEIMEELATRSRQC
YRHLIYEQPEFIEFFNEVTPIQEISQLQISSRPTRRGGKKTLESLRAIPWVFSWTQTRFL
LPAWYGVGTALKEFLEEKPAEHLSLLRYFYYKWPFFRMVISKVEMTLAKVDLEIARYYVQ
ELSQPQNREAFFRLYDQIAQEHRLTTELVLTITGHERLLDGDPALQRSVQLRNRTIVPLG
FLQVSLLKRLRQHNSQTTSGAILRSRYGRGELLRGALLTINGIAAGMRNTG
NT seq 3036 nt NT seq  +upstreamnt  +downstreamnt
atgacatcagtcctcgatgcgaccaatcgcgatcgcttaattgaaagtgaaagtttagca
gcccgtaccctacaggaacggttgcgactggtggaagaggtcttggtcgatgtcttggcg
gcagaatcgggtcaagaattggttgatctattgcggcgcttaggtgctctctcttcgcca
gaaggtcatgtgctccatgccccagaaggggaactgctcaaggtcattgaatccctcgaa
ctcaatcaagccattagagcggcccgtgcttttaacctctactttcaaattattaacatc
gttgagcagcactacgaacaacaatacaaccgcgaacgcgctgcccaagagagattgcgg
cgccgcagcgtcatgagtgaaccgatttccggtgtcagtggtgaaggttttccgctgcct
cataatgctgccaacgcaacggctgtgcgcagtgggccgagtgaacgcctagagcatagt
ctctacgaagccattcccgctactcagcagtatggttcctttgcttggctctttcctcgg
ctgcagatgctgaatgtgccgccgcgccatattcaaaagcttttggatcaactggacatt
aagctggtttttactgctcacccgacggagattgtacggcaaacaattcgtgataagcag
cggcgggttgcccgattactcgagcaactggatgtgctagagggggcttctgcacacctg
acggattggaatgcccaaactctacgggcacaactgatggaggaaattcgcctctggtgg
cgcacggatgagttgcaccaatttaagccggaagtgcttgatgaggtggaatacaccctc
cactacttcaaggaggtaatttttgctgtcattcccaagctctatcggcgcctggagcag
tcattgcatgaaacctttcccacgcttgagcccccccgtcacaatttctgccgctttggt
tcttgggtggggggcgatcgcgatggcaatccctatgtcaaaccagaagtaacgtggcaa
accgcctgctatcagcgcaacttagttcttgaggaatatattaagtccgttgagcgctta
atcaatttgctcagcctgtccctgcactggtgcgatgtgctgccggatttgctagattcc
cttgagcaggatcagcggcaactccctagtatctatgaccagtatgcggtgcgctatcgg
caggaaccctaccgcctgaaactggcctatgtgctcaaacggctgcaaaatacccgcgat
cgcaaccgggcgctgcaaacctactgcattcgccgccatgaggcggaagagttaaataat
gggcagttttactgccacggtgaagaattcttggcagaattgctgctaattcagcgtaac
ctcaaggaaacaggactggcctgccgcgaattggatgacttgatttgccaagtgcaggtc
tttggctttaatttggcagccttggatattcgccaagaaagcacctgtcacgctgaggcc
ctcaatgaaattaccgcctatttgggtattctcccctgtccctatacagaactctcagaa
accgaacgcactcgctggctcctcagtgaactctcgacccgtcgccccttgattccgggg
gaactcccctttagcgatcgcaccaatgaaatcattgaaacattccgcatggtgcggcaa
ctccagcaggaatttggcaccgatttgtgcaatacctacatcatcagcatgagccacgag
gtcagcgatctgttggaggtactcctctttgccaaggaggcaggcctctttgatccagcc
actggagctagtaccctgcaagccattcctctgtttgaaacggtcgaagatctcaaacac
gccccggcggtgctgacgcaactattctctctccccttttgccggagctatcttggaagc
aacagtaccccctttctgcaggaggtcatgctgggctattccgacagcaataaggattcc
ggctttctcagtagcaactgggaaatttacaaggcgcagcaacagctccagaaaattgct
gagaattttggcttccaactgcgcattttccacggtcggggtggctcagtgggtcggggt
ggtggacctgcctatgcagcgattttggcgcagccagcgcaaacgattaagggacgaatc
aagattactgagcaaggggaggtactggcttccaaatactcgttgccggaactagcgctc
tttaacctcgaaacagtggccacagcggtaatccaagctagtttgctgcgcagtagtatt
gatgaaattgagccttggcacgagattatggaggagttggccacgcgatcgcgccagtgc
tatcgccatctcatctatgagcagccagaattcattgaattctttaacgaagtcacccca
atccaagagattagccaactgcaaattagctcacggccaacacggcgggggggcaagaaa
acccttgagagcctgcgggcaattccttgggtctttagttggacgcaaacccgtttcctg
ctgccggcttggtatggtgtgggtactgccctaaaggaattccttgaggaaaaacccgct
gagcatctttccctcttgcgctacttctactacaaatggcctttcttccgcatggtgatt
tctaaggttgagatgacccttgccaaggtcgatctagagattgcccgctactatgtccaa
gaactcagccagccccaaaaccgtgaagccttcttccgcctctacgatcagattgctcag
gaacatcgcctgaccacggaattagtgctcacgattactggccatgagcggctactcgat
ggggatccggcgcttcagcgatcagtgcaactgcgcaatcgcaccattgttcctttgggg
ttcctgcaagtatctcttttgaaacggctgcgccagcacaatagccaaactacctctggg
gcaattttgcgctcccgctatggtcggggtgaattgctccggggggcactcttgaccatc
aatggcatagcagcggggatgcgcaatacgggctaa

DBGET integrated database retrieval system