KEGG   Candidatus Thioglobus autotrophicus: SP60_06725Help
Entry
SP60_06725        CDS       T04079                                 

Gene name
rbcL
Definition
(GenBank) ribulose 1,5-bisphosphate carboxylase
  KO
K01601  
ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
tho  Candidatus Thioglobus autotrophicus
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:tho00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    SP60_06725 (rbcL)
Enzymes [BR:tho01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     SP60_06725 (rbcL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1243915..1245333
Genome map
AA seq 472 aa AA seqDB search
MAKVYDAGVKDYRETYWMPDYTPLETDILACFKITPQDGVPREEVAAAVAAESSTGTWTT
VWTDLLTDLDHYKGRCYAIEDVPGDDTCFYGFVAYPIDLFEEGSVVNVMTSLVGNVFGFK
ALRALRLEDIRFPIAYVMTCNGPPQGIQLERDIMNKYGRPLLGCTIKPKLGLSAKNYGRA
CYEGLRGGLDFTKDDENVNSQPFMRWRARFDFVQEAIEKAEAETGERKGHYLNVTAPTSD
EMMKRAEYAKEIGSPIIMHDYITGGWSANTQLAQWCQDNGMLLHIHRAMHAVLDRNPHHG
IHFRVLTKILRLSGGDHLHSGTVVGKLEGDREATLGWIDIMRDSYIKEDRSRGIFFDQDW
GAMPGVIPVASGGIHVWHMPALVNIFGDDSVLQFGGGTLGHPWGNAAGAAANRVAVEACT
EARNQGRELEKEGKDILTTAAKHSPELAIAMETWKEIKFEFDTVDKIDAAHK
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaggtttatgatgcgggtgttaaagattaccgcgaaacatattggatgccggat
tacacaccgttagaaacggatatcctggcatgttttaaaatcacaccacaagacggtgta
ccacgtgaagaagtagcagcggcagtagcagctgagtcttctacaggtacttggactacg
gtgtggacagatctattaacagatcttgatcactataaaggtcgttgttatgcgatcgaa
gacgtaccgggcgatgatacatgtttctacggttttgttgcttacccaattgatcttttt
gaagaaggttcagttgtaaacgtaatgacatcattagttggtaacgtattcggctttaaa
gctctacgtgcacttagacttgaagatatcagattcccaattgcatacgtaatgacttgt
aacggtccaccgcaaggtatccagttagagcgtgacatcatgaacaaatacggtcgtcct
ttattaggttgtactattaagcctaagttaggtttatcagctaagaactatggtcgtgca
tgttatgaaggtcttcgtggtggtttagacttcacgaaagatgatgaaaatgttaactca
cagccgttcatgcgttggagagctcgttttgacttcgtacaagaagctatcgagaaagct
gaagctgaaactggtgagcgtaaaggtcactacctaaacgttactgcgccgacttctgat
gaaatgatgaagcgtgccgagtatgctaaagaaatcggttctccgatcattatgcatgac
tacattactggtggttggtctgctaacacgcagctagcacaatggtgtcaagacaacggt
atgttattacacattcaccgtgcaatgcatgcggtattagaccgtaacccgcatcacggt
atccatttccgcgtattgactaagatcttgcgtttatctggtggtgatcatttacactca
ggtactgttgtaggtaagcttgaaggtgaccgtgaggctactttaggttggatcgacatt
atgcgtgattcatacattaaagaagatcgttcacgcggtatcttctttgaccaagattgg
ggcgcaatgccgggtgtaatcccagtagcttctggtggtattcacgtatggcacatgcca
gcactagtaaacattttcggcgacgattctgtattacagtttggtggtggtacattaggt
cacccgtggggtaacgcagctggtgcagcagcaaaccgtgtagcggttgaagcttgtact
gaagctcgtaaccagggtcgtgagttagagaaagaaggtaaagacatccttactactgca
gctaagcacagtcctgaacttgctatcgcaatggaaacttggaaagaaatcaagtttgaa
ttcgatacagttgacaagattgacgcagcacataagtaa

DBGET integrated database retrieval system