KEGG   Thermotoga sp. RQ7: TRQ7_06395Help
Entry
TRQ7_06395        CDS       T03669                                 

Gene name
tuf
Definition
(GenBank) elongation factor Tu
  KO
K02358  
elongation factor Tu
Organism
thr  Thermotoga sp. RQ7
Brite
Translation factors [BR:thr03012]
 Eukaryotic Type
  Elongation factors
   TRQ7_06395 (tuf)
 Prokaryotic Type
   TRQ7_06395 (tuf)
Mitochondrial biogenesis [BR:thr03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    TRQ7_06395 (tuf)
Exosome [BR:thr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   TRQ7_06395 (tuf)
  Exosomal proteins of breast cancer cells
   TRQ7_06395 (tuf)
  Exosomal proteins of colorectal cancer cells
   TRQ7_06395 (tuf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1253752..1254954
Genome map
AA seq 400 aa AA seqDB search
MAKEKFVRTKPHVNVGTIGHIDHGKSTLTAAITKYLSLKGLAQYVPYDQIDKAPEEKARG
ITINITHVEYETEKRHYAHIDCPGHADYIKNMITGAAQMDGAILVVAATDGPMPQTREHV
LLARQVEVPYMIVFINKTDMVDDPELIELVEMEVRDLLSQYEYPGDEVPVIKGSALKALE
APDDPNHEAYKPIQELLDAMDNYIPDPQRDVDKPFLMPIEDVFSITGRGTVVTGRIERGR
IRPGDEVEIIGLSYEIRKTVVTSVEMFRKELDEGIAGDNVGCLLRGIDKDEVERGQVLAA
PGSIKPHKRFKAEVYVLKKEEGGRHTPFTKGYKPQFYIRTADVTGEIVGLPEGVEMVMPG
DHVEMEIELIYPVAIEKGQRFAIREGGRTVGAGVVTEVIE
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaggaaaagtttgtaagaacaaaaccccatgttaatgttggaaccatcgggcat
atcgaccacggaaaatccacgctgacagccgctataacaaagtacctttctctcaagggt
cttgcgcaatacgttccctacgatcagatcgacaaggctcctgaggaaaaggcaagaggt
atcactatcaacatcacgcacgttgaatacgaaaccgagaaaaggcactacgcacacatt
gactgtcccggacacgctgactacatcaagaacatgatcaccggtgctgcccagatggat
ggagccatactcgttgttgcagcaacggatggacctatgccacagacaagagaacacgtg
cttcttgcaagacaggttgaggttccttacatgattgttttcatcaacaaaacagatatg
gtcgacgatcccgaactcatcgaactcgtcgagatggaagtgagagatcttctgagtcag
tacgaataccccggtgacgaagtgcctgttataaaaggatccgctttgaaagctctcgaa
gccccagacgatccaaaccacgaggcttacaaacccattcaggaactgctcgacgccatg
gacaactacattccagatcctcagagagacgttgacaaaccgttcctcatgcccatcgaa
gacgttttctccatcacgggaagaggaacggttgttacaggaagaatcgaaagaggaaga
atcagacccggtgacgaagtcgagatcataggactcagttatgagatcagaaagacagtc
gttacaagcgttgaaatgttcagaaaagaactcgacgaaggtatcgctggtgacaacgtg
ggatgtctgctcaggggaatcgacaaggacgaagtcgaaagaggtcaggttcttgcagct
cctggtagcattaaaccccacaagaggttcaaagcagaggtctacgttctgaagaaagag
gaaggtggaaggcacacaccgtttacaaaaggttacaaacctcagttctacataagaaca
gctgacgttactggtgaaatagtgggacttccggaaggagtcgaaatggttatgcctgga
gaccacgttgagatggaaatagagctcatctaccccgttgctattgagaaagggcagaga
ttcgctataagagaaggcggaagaacagttggagctggcgttgtcacagaagttatcgag
tga

DBGET integrated database retrieval system