KEGG   Thauera humireducens: AC731_010250Help
Entry
AC731_010250      CDS       T04211                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
thu  Thauera humireducens
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:thu00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    AC731_010250
  Energy metabolism
   00680 Methane metabolism
    AC731_010250
Enzymes [BR:thu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     AC731_010250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2170176..2172926
Genome map
AA seq 916 aa AA seqDB search
MTQDKDAPLREDIRLLGRLLGDTVRDQQGAAAFELIERIRQNSVRFRRDDDIAARRELED
MLDALSRDQTIQVVRAFSYFSHLANIAEDQHHIRRSRAHLIAGSAPREGSLAHALEAALA
SGTTDAAGLVEFFDTARVSPVLTAHPTEVQRKSILNCETVIARLLDERDRMQLTPEESEA
NLEALRRAVLTLWQTRILRTAKLSVIDEVNNGLSYFDTTFLRELPRLYASLEDRLATAAP
GLTGTELANFLQVGSWIGGDRDGNPFVTAEVLDKALAMHAAVALEYYLNELHTLGSQLSM
SHGFVSASDALLALAEHSGDHSPHRSDEPYRRAVSGLYARLAATYRELLGHEPARHAVAR
AEPYADAAALSEDLDTLHRSLVANGSAALSRGRLRQLRRAVKVFGFHLAPIDLRQNSDVH
ERVVAELLETARPGTDYRAQDETGRCALLLEELATARPLASPHVRYSDETEGELAIFRTA
RRAHQRYGRAAIRHCIISKTDDVSDLLELAVLLKEAGLLRPLENALDVDIVPLFETIGDL
ENAAGVMERLFSLPIYRNLLAARGQTQEVMLGYSDSNKDGGFLTSGWALYKAEGELVATF
ARHGVRLRLFHGRGGSVGRGGGPSYQAILAQPDGAVQGQIRLTEQGEVIGAKYGNPEVGR
RNLEVLVAATLETSLRPAGAEPTPPAFMDAMQALSDAAFTAYRGLVYDTEGFERYFWEST
VISEIAALNIGSRPASRKKSTAIEDLRAIPWVFSWSQCRVMLPGWYGFGSAVQAFLARHP
QDGLALLQRMHREWSFFATLLSNMDMVLAKSDLAIASRYADLVKDVALREAIFGRIRAEH
QATVEALLQITGQRELLEANPLLKRSIRNRFPYLDPLNHVQVELLRRHREHGDDPRIRNG
IHISINGIAAGLRNSG
NT seq 2751 nt NT seq  +upstreamnt  +downstreamnt
atgacccaggacaaagacgcgccgctgcgcgaagacatccgcctgctcgggcgcctgctc
ggcgacaccgtgcgcgaccagcagggcgccgccgccttcgagctgatcgagcgcatccgc
cagaactccgtgcgctttcgccgcgacgacgacatcgccgcgcggcgcgaactcgaggac
atgctcgatgcgctgtcgcgcgaccagaccatccaggtcgtgcgcgccttcagctacttc
tcgcacctggccaacatcgccgaggaccagcaccacatccgccgctcgcgcgcgcacctg
atcgcgggctccgccccgcgcgaaggcagcctcgcccatgcgctcgaggcggcgctcgcc
agcggcacgaccgacgccgccgggctggtcgagttcttcgacaccgcccgcgtctcgccg
gtgctcaccgcccaccccaccgaggtgcagcgcaagagcatcctcaactgcgagacggtg
atcgcacgcctgctcgacgagcgcgaccgcatgcagctcaccccggaggaatccgaggcc
aacctcgaggcgctgcgccgcgcggtgctcacgctgtggcagacgcgcatcctgcgcacg
gccaagctgtcagtgatcgacgaggtcaacaacggcctgtcctacttcgacaccaccttc
ctgcgcgagctgccccgcctctacgccagcctggaggaccgtctcgccaccgccgcgccg
ggcctgaccggcaccgagctggccaacttcctgcaggtcggcagctggatcggcggcgac
cgcgacggcaaccccttcgtcaccgccgaggtgctcgacaaggcgctggcgatgcacgcc
gcagtggcgctcgagtactacctcaacgagctgcacacgctgggctcgcagctgtcgatg
agccacggcttcgtgagcgcctcggacgcgctgctggcgctggccgagcactcgggcgac
cactccccgcaccgcagcgacgagccctaccgccgcgcggtgtccggcctctacgcccgg
ctggccgccacctaccgcgaactgctcggccacgaacccgcgcgccacgccgtcgcccgc
gccgaaccctatgccgatgcggccgcgctgtccgaggatctcgacaccctgcaccgctcg
ctggtggccaacggctcggccgcgctcagccgcgggcggctgcgccagctgcgtcgcgcg
gtgaaggtgttcggctttcatctggcaccgatcgacctgcgccagaactcggacgtgcat
gagcgggtggtcgccgaactgctcgagaccgcccgccccggcaccgactaccgcgcccag
gacgaaaccggccgctgcgcgctgctgctcgaggaactggccaccgcgcgcccgctcgcc
tcgccccacgtgcgctactcggacgaaaccgaaggcgagctggcgatcttccgcacggcg
cgccgcgcgcaccagcgctacggccgcgctgccatccgccactgcatcatctccaagacc
gacgacgtatccgacctgctcgagctggcggtgctgctgaaggaagccggcctgctgcgc
ccgctcgagaacgcgctcgacgtcgacatcgtgccgctgttcgagaccatcggcgacctg
gagaacgccgccggggtcatggagcgcctgttctcgctgcccatctaccggaacctgctg
gccgcccgcggccagacccaggaggtgatgctgggctactcggacagcaacaaggacggc
ggcttcctgacctcgggctgggcgctgtacaaggccgagggcgagctggtggcgaccttc
gcgcgccacggcgtgcgcctgaggctctttcacggtcgcggcggctcggtgggccgcggc
ggcgggccgagctaccaggccatcctcgcccagcccgacggggcggtgcagggccagatc
cgcctcaccgaacagggcgaagtgatcggcgccaagtacggcaacccggaagtgggccgg
cgcaacctggaggtgctggtcgcagccacgctcgagaccagcctgcgcccggccggggcc
gagcccacgccgcccgcgttcatggacgcgatgcaggcgctgtcggacgcggccttcacc
gcctaccgcggcctggtgtacgacaccgagggcttcgagcgctacttctgggaatccacg
gtgatcagcgagatcgccgcgctcaacatcggcagccgccccgcctcgcgcaagaagagc
accgcgatcgaggacctgcgcgccataccctgggtcttcagctggtcgcagtgccgggtg
atgctgccgggctggtacggctttggcagcgcagtgcaggccttcctcgcccggcatccg
caggacggcctggcactgctgcagcgcatgcaccgcgagtggtccttcttcgccacgctg
ctgtcgaacatggacatggtgctcgccaagagcgacctcgcgatcgccagccgctacgcc
gacctggtcaaggacgtggcgctgcgcgaggcgatcttcgggcgcatccgcgccgaacac
caggccacggtcgaggcgctgctgcagatcaccggccagcgcgagctgctcgaggccaac
ccgctgctcaagcgttcgatccgcaaccgcttcccctacctcgatccgctcaaccacgtg
caggtcgagctgctgcgccgtcaccgcgagcacggcgacgacccgcggatccgcaacggc
atccacatctcgatcaacggcattgccgcgggattgcgcaacagcggctga

DBGET integrated database retrieval system