KEGG   Thauera humireducens: AC731_015625Help
Entry
AC731_015625      CDS       T04211                                 

Definition
(GenBank) acyl-phosphate glycerol 3-phosphate acyltransferase
Organism
thu  Thauera humireducens
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(3356209..3359052)
Genome map
AA seq 947 aa AA seqDB search
MPAPSAHAHPPDAEALLRLIDEVVRELQPGTTRRASLDSPLDRELGLDSLSRVELLARIE
RRFVLRLPTEVLADAETPRDLLHALAQAARAPTPSPRSADMEGGMPPPQPSAPEPATAGA
TPPLPASAATLVEVLEWHVARHPERVHVRFLVDDAHAETLTCAQLHEAATRFAGALVALG
VRPGDCVALMLPSGLDFFRCFFGILFAGAVPVPMYPPARPNQIEEHLRRQAGILHNCEAW
VLITFDRVRPLARMLAGLVPTLAHVSTPDALAASGRAPLPPQPLRSAALGLIQYTSGSTG
DPKGVALSHANLLANIRAWGRAAALGPQDVCVSWLPLYHDMGLIGTWLGSLYHGLPLVLM
SPLDFLARPERWLWAIHHYRGTVTAAPNFAFELCVRRLADTELDGLDLSSWRLAANGAEP
VNPDTLARFAAAFSRYGLDAHSLMPVYGLAECAVGLCVPPPGRGVVIDHVQRSSVRLGTQ
VRPATNDSDTLRLVSCGPALPGHALRIVDADGHPLPERCVGAVEFRGPSATAGYYRNPAA
TAALIRDGWLATGDHGYLADGELYLTGRAKEMIIRAGRNLYPYDLEQAAGELPGVRKGCV
AVFGTLVPGEVDERLVVVAETRTSDPQTRAALEARITAAAMEQFGLAPDAVVLAPPHAVL
KTSSGKIRRAAVRDAYLAGTLGAPSRATWLQVLRLQRASLAGRARRAAETVPHQLRAAWA
WFAFMLLAPIATLAILVLPRLEQRWTACHRIARLHAWLCGCTLRVEGVDHLPAKGCVLVA
NHASYIDGLVLAAALPQPVRFVAKAELRDNRLLRPLFERMGTHFVRRFDAAHGVEDADTL
AAGAGTGAPLLFFAEGTFSARPGLQAFRLGAFQAAARQHLPVVPVALAGTRAVLPDGSWR
PRPGALAVTVCAPLQPDGEDWHDLLALRDAVRADILAHCGEDDATRR
NT seq 2844 nt NT seq  +upstreamnt  +downstreamnt
atgcctgccccctctgcccacgcccacccgcccgacgccgaagcgctgttgcgcctgatc
gacgaggtcgttcgcgaactgcaacccggcacgacgcggcgcgccagcctcgacagtcct
ctcgaccgggaactcggcctcgacagcctgagccgcgtcgaactgctcgcccgcatcgag
cgccgcttcgtcctacgcctgccgaccgaggtgctcgccgacgccgagacgccgcgcgac
ctgctgcacgccctggcgcaggccgcccgcgcccccacaccatcgccccgcagcgccgac
atggagggcggcatgccgccgccgcaaccctccgcccccgagccggcaacggccggcgcc
acgccgccgctcccggcgtccgccgcaaccctggtcgaggtcctcgaatggcacgtcgca
cgccatccggagcgcgtccacgtccgcttcctggtcgatgacgcgcatgcggagacgctc
acctgcgcgcaactgcacgaggcggccacgcgctttgccggcgcgctcgtcgcactcggc
gtgcgccccggcgactgcgtggcgctgatgctgccctcgggcctggacttcttccgctgc
ttcttcggcatcctgttcgccggcgcagtgccggtaccgatgtatccgccggcgcgcccc
aaccagatcgaggagcacctgcgccgacaggccgggatcctgcacaactgcgaagcgtgg
gtgctgatcaccttcgaccgcgtgcgcccgctggcccgcatgctcgccgggctggttccc
accctcgcccatgtcagcacgccggacgcgctggccgcaagcggacgcgcacccctgccg
ccgcagccgctacgcagcgccgcgctcggcctgatccagtacacctccggctccaccggc
gaccccaagggcgtcgccctgagccacgccaacctgctcgccaacatccgcgcctggggc
cgcgccgccgcgcttgggccgcaggatgtgtgcgtgagctggctgccgctgtatcacgac
atgggcctgatcggcacctggctcggcagcctgtaccacggcctccccctggtgctgatg
tcgccgctcgacttcctcgcccggcccgagcgctggctgtgggcgatccaccactaccgc
ggcacggtcaccgcggcgcccaacttcgccttcgagctgtgcgtaaggcgtctggccgac
accgagctggacgggctcgacctgtcgtcctggcgactggcagcgaatggcgccgaaccg
gtcaaccccgacaccctggcgcgcttcgctgcggccttcagccgctacggcctggatgcg
cacagcctgatgcccgtgtacggcctggccgaatgcgccgtgggcctgtgcgtgcccccg
ccggggcgcggtgtggtgatcgatcacgtgcagcgatccagcgtgcgcctcggcacccag
gtcaggcccgcgacgaacgacagcgacacgctgcgtctcgtgtcctgcggcccggccctg
cccggccacgcactacgcatcgtcgacgccgacggccaccccctgcccgagcgctgcgtc
ggcgcagtcgaattccgcggcccctcggccaccgccggctactaccgcaatccggcggcc
acggccgcgctgatccgcgacggctggctcgccaccggcgaccacggctacctggccgac
ggcgagctctacctcaccggccgggcaaaggagatgatcatccgcgccggccgcaacctc
tacccctacgacctcgagcaagcggcgggcgaactgcccggcgtgcgcaagggctgtgtc
gcggtgttcggcaccctcgtgccgggcgaggtggacgagcgcctggtcgtggtggccgag
acgcgcaccagcgatccgcagacgcgggcggcgctcgaggcccgcatcaccgccgccgcg
atggaacagttcggcctcgcgcccgacgcggtcgtgctcgcgccgccgcacgcggtgctc
aagacctccagcggcaagatccgccgcgccgccgtccgcgacgcctacctcgccggcacc
ctcggcgcccccagccgcgccacctggctgcaggtgctgcggctgcagcgggcgagtctc
gccggccgcgcgcgccgggccgcggagacggtcccacaccagctccgggcggcgtgggcg
tggttcgccttcatgctgctcgcgccgatcgccacgctggccattctcgttctgccacgc
ctcgagcagcgctggacggcctgccaccgcatcgcccgcctgcatgcgtggctatgcggc
tgcacgctgcgggtcgagggcgtcgaccacctgccagccaagggctgcgtgctcgtcgcc
aaccacgccagctacatcgacggcctcgtgctcgccgccgcgctgccgcagccggtgcgt
ttcgtggccaaggccgagctgcgcgacaaccgcctgttgcggccgctgttcgagcgcatg
ggcacgcatttcgtacgtcgtttcgacgccgcacatggtgtcgaagacgccgacacgctc
gccgccggagccggcacaggtgcgccactgctgttcttcgccgagggcaccttcagcgcc
cgccccggcctgcaggccttccgcctcggcgccttccaggcggccgcgcgccagcacctg
cccgtggtgccggtcgcgctcgccggcacccgtgcggtgctgcccgacggcagctggcga
ccgcggcccggcgcgctcgcggtgacggtctgtgcgcccctccaacccgatggcgaggac
tggcacgacctgctcgccctgcgcgacgcggtgcgggccgacatcctcgcgcactgcggc
gaggacgatgcgacccggcgctga

DBGET integrated database retrieval system