KEGG   Thermococcus sp. 2319x1: ADU37_CDS07760Help
Entry
ADU37_CDS07760    CDS       T04245                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase, archaeal
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
thv  Thermococcus sp. 2319x1
Pathway
thv00620  Pyruvate metabolism
thv00680  Methane metabolism
thv00720  Carbon fixation pathways in prokaryotes
thv01100  Metabolic pathways
thv01120  Microbial metabolism in diverse environments
thv01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:thv00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    ADU37_CDS07760
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    ADU37_CDS07760
   00680 Methane metabolism
    ADU37_CDS07760
Enzymes [BR:thv01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     ADU37_CDS07760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase_2 HpcH_HpaI PEPcase
Motif
Other DBs
NCBI-ProteinID: ALV62475
UniProt: A0A0U3S7T7
LinkDB All DBs
Position
665954..667384
Genome map
AA seq 476 aa AA seqDB search
MIPRTMSTQHPDNVYIPFFAQEPQLSGEDEIIEAFYAFSVLGVEEQMWDFEGKEVDEFVV
KKLLEKYPHFFRKHRLGRDFRITPRVPNPSVEKAEAKLLLETLESIPRSADYARLFYGEK
VAPIFEVILPMTTFSEEIERVYELYRRYIIGKQYKRVYDVKIYEWIGEFFPEEINVIPLF
ETKEAILNSHEILEEYLTGKNFEYQRVFLARSDPAMNYGLISAVMYDKYALFKLQELEEE
LSIPLYPIIGVGGAPFRGHFTPKNVDAVMEEYPSAQTFTVQSSFKYDNEPKEVIKAIEKV
NDTKRKETQAIDEKIFEILDKYEEEYTKELKILAPYIREVAKAVPSRRKRKLHIGLFGYS
REVNGEALPRAIKFTASLYSLGIPPEILGLRALSEGELERISEHYRGLYNDISFALRFFN
PKAASRFKFLGDIAKMQKEMGVEKDERHLSITTQILNGKIEESLVVEAASIRGFLG
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgataccaagaacaatgagtacccagcatcctgacaatgtgtatatacccttctttgct
caggagccccagctgagtggggaggatgaaataattgaagcgttctatgcttttagcgtt
cttggggtagaggagcaaatgtgggactttgaaggaaaggaagtggatgagtttgttgtt
aaaaagcttctggagaaatatcctcatttcttccgaaagcacaggcttggtagggacttc
agaataaccccccgcgtgccaaacccgagcgtggagaaagcagaggcaaagctcttgctt
gaaacccttgaaagcattcctagatctgccgattatgcaaggttattttacggagagaaa
gtcgccccaatttttgaagtcatcttgcccatgacaaccttctcagaggaaatcgaaagg
gtgtatgagctttacagaaggtatatcataggaaagcagtacaaaagggtgtacgacgtt
aaaatctatgaatggattggagagttttttccggaagagataaatgtcatacccctattt
gagacaaaagaggccatcctgaactcgcatgaaatcctggaggaatatctaaccggaaaa
aactttgagtaccagagggtgtttttagcaagaagcgaccccgcaatgaactatggcctc
ataagtgcggtaatgtacgacaaatatgctttattcaaactccaagaacttgaagaagag
ctaagcatccccctatatccaataatcggtgttggtggagccccttttaggggacatttc
acacccaagaatgtcgatgcagtaatggaagaatatccaagcgcccagaccttcaccgtc
caaagctcatttaaatatgataatgagcctaaagaagttatcaaagctattgaaaaggta
aacgatacaaaaagaaaagaaacgcaagcaattgatgagaagatatttgagatactcgac
aaatatgaggaagaatacaccaaggaacttaagattctcgccccctatatacgggaggtt
gcaaaggctgttccctcaaggaggaaaaggaagcttcacatagggctctttggatattca
agggaggtcaacggagaagcccttccaagggctataaagttcacggcatctctgtattcc
cttggaatacccccggaaatcctaggattaagggcactgagcgaaggggagctggagagg
ataagtgaacactacagggggctttataatgatatatcttttgcattaaggttctttaat
ccaaaagcagcctcccgttttaaatttctgggggatatagccaaaatgcaaaaagaaatg
ggcgtagaaaaggatgaaaggcatttaagcataaccacccaaatactgaatggaaaaatt
gaagagagccttgtggtagaggcagccagtatcagaggatttctcgggtaa

DBGET integrated database retrieval system