KEGG   Thermococcus sp. 2319x1: ADU37_CDS09510Help
Entry
ADU37_CDS09510    CDS       T04245                                 

Definition
(GenBank) Glycerol-3-phosphate dehydrogenase
  KO
K00111  
glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
thv  Thermococcus sp. 2319x1
Pathway
Glycerophospholipid metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:thv00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    ADU37_CDS09510
Enzymes [BR:thv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     ADU37_CDS09510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
815576..817066
Genome map
AA seq 496 aa AA seqDB search
MKTRAVIIGAGISGASIARVLSRYENLEVHLIEKNADVGWGVSKANTALIHGGYDDDPEK
YPTRAKLCIKGNRLWHEWVKELEIPHIWNGALIVALEDEDFKELEKLLERGRKNGVPEMR
IVGREELFHLEPNLNPEALGGLWVPIVGQIGPIPAVIAIVENAVANGVKLHLETEVRGIK
VEGGEVKGVETNNGFIEADIIINAAGLYADEISRMVGVNDFEIHPRKGEYWIFDDDIPGP
RRVLFPTPTPKSKGVVVTTEISGHLMIGPNAQDLPREEKENTATTREGLEEVWKKARELW
PNLPPRSKVIRTFAGLRPEPTGGDFIIRAEKEVWGFINVAGIRSPGLTSAPAIAYEVRDI
IKRDLGIKLVEKKKWNPYRKDITHFFMLSREKANELVKQNPSYGKIVCRCNHVSEGDILE
AIERMKLIGVKTPSIDSIKVRTKATSGTCQGSFCRVRIARILAREYGVDLWDVTLKGKGS
EIGIGDVKVLLRGEVE
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgaagacaagagctgtcataataggcgctggaataagcggtgcgagcatagcacgtgtt
ttaagcagatatgaaaatcttgaagttcatctgattgaaaagaacgccgacgttggctgg
ggcgtgagcaaagccaacaccgccctcatccacggcggctacgatgatgaccctgagaag
tacccaacaagggcaaagctttgcataaagggaaaccgcctctggcatgagtgggtaaaa
gaactcgagattcctcacatctggaacggggctttgatagtcgcgttggaagatgaagac
ttcaaggaacttgagaagctcttagagagggggagaaaaaacggagttccagagatgagg
attgtcggtagggaggagctcttccaccttgaacccaaccttaatccagaagctcttggt
gggctttgggttcctatagttggtcagataggcccgattccagcggttattgcaatagtg
gagaatgccgttgcaaatggagtaaaacttcaccttgaaacagaggtcagagggataaaa
gttgaaggaggggaagtgaaaggcgttgaaactaacaacggcttcattgaagcggatata
atcataaacgccgcaggactgtatgcggatgaaatctccagaatggtaggagtgaatgac
tttgagattcacccgagaaaaggcgaatactggatttttgatgacgatatacccggtcca
agaagggttctcttccctacaccaactccaaagagcaagggtgtagttgttaccacggag
ataagcggtcatctgatgattgggccaaatgctcaagatttgccaagggaggagaaagag
aatacagccaccaccagagaagggctcgaagaggtgtggaaaaaagcaagggagctctgg
ccgaacttgcctccaagaagcaaggtaataaggacgtttgccggattgaggcccgaaccc
acaggaggagacttcattataagggcagaaaaggaggtttggggatttatcaacgttgcc
ggcatccgctctccaggcttaacaagtgctcctgccatagcatatgaggttagggatata
ataaagcgagatctcgggataaagttagttgaaaagaaaaaatggaacccttaccgcaaa
gacataacgcacttcttcatgctttccagggaaaaagcaaacgagctcgtgaagcaaaat
ccatcttatggaaagattgtatgcaggtgcaaccacgtaagcgagggtgacattctggag
gctattgagagaatgaaacttataggcgtcaagactccaagcatcgactcaatcaaagta
agaacaaaagccacaagcgggacatgtcagggaagcttctgcagggtaaggatagcaagg
atactggcgagagaatatggggtagacctctgggatgtgaccctcaaaggaaagggaagc
gagattggtattggggatgtaaaggttctcctcaggggtgaagtggagtga

DBGET integrated database retrieval system