KEGG   Thermoanaerobacter italicus: Thit_1977Help
Entry
Thit_1977         CDS       T01178                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  
elongation factor Tu
Organism
tit  Thermoanaerobacter italicus
Brite
Translation factors [BR:tit03012]
 Eukaryotic Type
  Elongation factors
   Thit_1977
 Prokaryotic Type
   Thit_1977
Mitochondrial biogenesis [BR:tit03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    Thit_1977
Exosome [BR:tit04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Thit_1977
  Exosomal proteins of breast cancer cells
   Thit_1977
  Exosomal proteins of colorectal cancer cells
   Thit_1977
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
complement(2015380..2016582)
Genome map
AA seq 400 aa AA seqDB search
MAKQKFERTKPHVNVGTIGHVDHGKTTLTAAITMVLSNAGLAEKKGYDEIDKAPEERARG
ITINTTHVEYETEKRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLARQVGVPYIVVFLNKADMVDDAELIELVEMEVRELLNEYEFPGDDTPIVVGSALKALE
CGCGKRECEWCGKIWQLMDVVDEYIPTPERDIDKPFLMPVEDIFTITGRGTVATGRVERG
KVKVGDEVEIIGLTTESKKTVVTGVEMFRKTMDEAQAGDNIGVLLRGIQRDEVERGQVLA
KPGTIKPHMKFEGQVYVLTKEEGGRHTPFFNGYRPQFYFRTTDVTGTIQLPEGVEMVMPG
DHVTIKVELITPIAMEEGLKFAIREGGRTVGAGVVSAIIE
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagcaaaaatttgagaggacgaaaccgcatgtaaatgtagggacgatagggcac
gtagaccatggtaagacgacattaacagcggcgataacgatggtattatccaatgcaggg
ttagcagagaagaaaggatatgacgagatagacaaggcaccggaggagagagcaagggga
ataacaataaacacgactcacgtagaatatgagacagagaagaggcactatgcgcatgta
gactgtccaggtcacgcggactacgtaaagaacatgataacaggtgcagcacagatggac
ggagcgatattggtagtatcagcagcagacggtccgatgccacagacgagggagcacata
ttattagcgaggcaggtaggagtgccatatatagtagtatttttaaacaaggcagacatg
gtagacgatgcagaattaatagagctggtagagatggaagtaagggagttattaaacgaa
tatgaatttcctggggatgacacaccgatagtagtaggttcagcattaaaggcattagaa
tgtggatgtggcaagagagaatgcgaatggtgcgggaagatatggcagttaatggatgta
gtagacgaatatataccgacaccggagagggacatagacaagccatttttaatgccagta
gaggacatatttacaataacgggaagagggacagttgcgacagggagagtagagagaggc
aaagtaaaagtaggggacgaagtagagataatagggcttacgacagaatctaagaagaca
gtagtgacaggggtagagatgttcaggaagacgatggacgaagcgcaagcaggggacaac
ataggagtgttattaagagggatacagagggacgaagtagagagagggcaagtattggcg
aagccagggacgataaagccgcacatgaaatttgaggggcaggtatacgtattgacgaag
gaagaaggaggaaggcatacaccatttttcaatggatacaggccacaattttactttagg
acgacagacgtaacagggacgatacagttaccagagggagtagagatggtgatgccgggg
gaccacgtaacgataaaagtagagttaataacaccgatagcgatggaagaaggtttgaag
tttgctataagagaaggcggccgtacagtaggtgctggcgtcgtgtcagctatcatagaa
tag

DBGET integrated database retrieval system