KEGG   Thermincola potens: TherJR_2326Help
Entry
TherJR_2326       CDS       T01226                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
tjr  Thermincola potens
Pathway
tjr00010  Glycolysis / Gluconeogenesis
tjr00030  Pentose phosphate pathway
tjr00051  Fructose and mannose metabolism
tjr00052  Galactose metabolism
tjr00680  Methane metabolism
tjr01100  Metabolic pathways
tjr01110  Biosynthesis of secondary metabolites
tjr01120  Microbial metabolism in diverse environments
tjr01130  Biosynthesis of antibiotics
tjr01200  Carbon metabolism
tjr01230  Biosynthesis of amino acids
tjr03018  RNA degradation
Module
tjr_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:tjr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TherJR_2326
   00030 Pentose phosphate pathway
    TherJR_2326
   00051 Fructose and mannose metabolism
    TherJR_2326
   00052 Galactose metabolism
    TherJR_2326
  Energy metabolism
   00680 Methane metabolism
    TherJR_2326
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    TherJR_2326
Enzymes [BR:tjr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     TherJR_2326
Protein phosphatases and associated proteins [BR:tjr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     TherJR_2326
Messenger RNA biogenesis [BR:tjr03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     TherJR_2326
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat
Motif
Other DBs
NCBI-ProteinID: ADG83167
JGI: TherJR_2326
UniProt: D5XA34
LinkDB All DBs
Position
complement(2401536..2402498)
Genome map
AA seq 320 aa AA seqDB search
MKRIGVLTSGGDAPGMNAAIRAVVRKGIFEGLEVVGIKRGYAGLINGEFVDMNLGSVADI
IQRGGTILRTARSEEFRTVEGRRRAYANMQEQGIEGLIVIGGDGSFRGAQIFSQEHGVKV
IGIPGTIDNDIPCSDYSIGFDTSVNTVVDAINKIRDTATSHERTYVIEVMGRHAGYIALE
AGLAGGAESILIPEIPFSIDEIIEKLHRGQKRGKLHSIIVVAEGAASGIEIGKQIKEKTG
FDTKVTILGHLQRGGTPTAFDRVLASRMGALAVDLIKAGASGKMIARQHNDLVAVDFDCA
LSEKRTIDHSVYELAGILAI
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
ttgaagagaattggagtcttgaccagcggcggagatgcgccgggcatgaatgcagctatc
cgggcagttgtgcgcaaaggtatttttgaagggctggaagttgttggtatcaaacgcggg
tacgccggtttgattaacggtgagtttgtggatatgaatctgggttccgtggctgatatt
attcagcggggcggtaccattctgcggactgcccgttccgaggaattccgtactgtagaa
ggcaggcgtcgtgcttatgccaatatgcaggaacagggtattgaaggactgatagttatt
ggcggggacggttctttccgcggtgcccaaatttttagccaagaacatggcgtcaaggta
atcggcataccgggcactatagataatgacattccctgcagtgattattctatcggtttt
gatacctctgtgaatacagtggtggatgccataaacaaaattcgtgatacggctacttcc
catgagcgtacttacgtaatcgaggttatgggcaggcacgcggggtatatagccctggaa
gcaggcttggccggaggcgcggaatcaattttgattcccgaaatccctttcagtatcgat
gagattattgaaaaactgcaccgggggcagaaaagaggaaaattgcacagtatcatagta
gttgcggaaggtgctgccagcggtattgaaataggaaagcagatcaaagaaaaaacgggg
tttgacaccaaggtgaccattcttggccatctccaaaggggaggtacgcctacggccttt
gaccgggtgctggccagccggatgggcgctttggctgttgatttgataaaagccggggcg
agcgggaagatgattgcccgccagcataacgacttagtggccgttgactttgattgtgct
ttaagcgaaaaacggactatcgaccattctgtttatgagctggccggcatactggcaatt
taa

DBGET integrated database retrieval system