KEGG   Thermoanaerobacter kivui: TKV_c16900Help
Entry
TKV_c16900        CDS       T03397                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase PfkA
  KO
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
tki  Thermoanaerobacter kivui
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:tki00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TKV_c16900 (pfkA)
   00030 Pentose phosphate pathway
    TKV_c16900 (pfkA)
   00051 Fructose and mannose metabolism
    TKV_c16900 (pfkA)
   00052 Galactose metabolism
    TKV_c16900 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    TKV_c16900 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    TKV_c16900 (pfkA)
Enzymes [BR:tki01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     TKV_c16900 (pfkA)
Protein phosphatases and associated proteins [BR:tki01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     TKV_c16900 (pfkA)
Messenger RNA biogenesis [BR:tki03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     TKV_c16900 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(1619520..1620485)
Genome map
AA seq 321 aa AA seqDB search
MKTIGILTSGGDAPGMNAAIRAVVRTGIYYGLKVKGIMRGFAGLVEDEVIDLNLSSVGDI
LQKGGTILRTARCEEFKKKEVRKKAYETLQKHGIEGLVVIGGDGSFRGAQLLSEEWNVNT
IGIPGTIDNDIPCTDYTIGFDTACNTVIDAINKIRDTATSHERANIIEVMGRNAGYIALY
AGVAGGAEMIILPEVEWSIDELCDKITYGIKRGKLHHIIVLAEGVMSAPELAKMIKERLP
KLDLRYTILGHIQRGGAPTVMDRVLASQMGARAVELLLENKTKRIISIRNNQIVDDDIDE
ALSMKKEFNRKLYELSKILSI
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacaattgggatacttacaagtggtggagatgcaccagggatgaacgcagccata
agggctgtggtaagaacaggaatttattatgggcttaaagtaaagggaatcatgagagga
tttgcaggtttagtagaggatgaagttattgacctaaacctttcttctgtaggagatata
ttgcaaaaaggcggtactattttgaggactgccagatgtgaagaattcaagaaaaaagaa
gtgcgaaaaaaagcttatgaaactcttcaaaaacacggaatagaaggtttagtagttatt
ggaggagatgggtctttcagaggagcccaacttttgagtgaagagtggaatgtaaatact
attggaattcctggaacaattgataatgacattccttgtactgattatacaataggtttt
gatacagcgtgtaatacggttattgatgcaataaataaaataagagatacagctacttct
catgaaagagcaaatataatagaagtgatgggaagaaatgcgggttacattgctttgtat
gctggtgtagcaggaggagcagaaatgattatactccctgaggtggagtggagcattgat
gaactttgcgataaaattacttatgggataaaaagaggtaaacttcatcatataattgtc
cttgcagaaggagttatgagtgctccagaacttgcaaaaatgattaaggagaggttacct
aaattggatttaaggtatactattttgggacacattcaaagaggtggagctccgacagtg
atggacagagtgctggcaagccaaatgggagcaagagctgtagaattacttttggaaaac
aagacaaaaaggataataagcatacgaaataatcaaattgtggatgatgatatagacgaa
gctctctctatgaagaaagagtttaacagaaaattgtatgaattgagcaaaattttgtct
atataa

DBGET integrated database retrieval system