KEGG   Thermoanaerobacter kivui: TKV_c19040Help
Entry
TKV_c19040        CDS       T03397                                 

Gene name
ligD
Definition
(GenBank) end joining DNA repair protein LigD
  KO
K01971  
bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
tki  Thermoanaerobacter kivui
Pathway
Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:tki00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    TKV_c19040 (ligD)
Enzymes [BR:tki01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     TKV_c19040 (ligD)
DNA repair and recombination proteins [BR:tki03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     TKV_c19040 (ligD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1840187..1841110
Genome map
AA seq 307 aa AA seqDB search
MSMIEEKISPMLASSSDPFDSPEWIYEIKWDGSRTIAFLSNKTRLQDRKLVDITHQFPDL
ALLHKQIKAKEAILDGELVVLKNGKPSYKSIMSRKHQQNLVKINLLSKIMPVIFITWDIL
YLDGKPLVELPLIERKDILRKTVKESEVIKISDFIFEHGKMLFEETGKRGLEGIVAKKAD
SKYLIGKRSKLWLKSKHFIVINAVIIGYRTDKTALILGLYDEENNLINIGSCESGLSQKE
LKAFYEVAKGIKAPDNYYNFKEKNVQWLKPLLTCKVRFMEWSENMKMRAPSFIQFEYNVK
PEECRFE
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgtctatgatagaagaaaaaatatcacctatgctggcatccagcagtgacccttttgat
agccccgaatggatatatgaaatcaaatgggatggttcaaggactattgcctttctttca
aataaaacaagacttcaagatagaaagcttgttgatataacccaccagtttccagattta
gcattacttcataagcaaataaaagcaaaagaagcaatacttgacggtgaacttgtagtt
ttaaaaaacggcaagcccagttacaaaagcattatgtcgagaaagcatcaacaaaattta
gtaaaaataaatcttttaagcaagataatgcccgtaattttcataacatgggatatattg
tacttagacggtaaacctcttgttgaattgccacttatagagagaaaagatatacttaga
aaaacagttaaagaaagcgaggtcataaaaatatcagattttatatttgaacatggaaaa
atgctttttgaagagacaggcaaaagaggacttgaaggaattgttgccaaaaaagcagat
tcaaaatatttaataggaaaaaggagtaaactctggcttaagtcaaaacattttattgta
ataaatgccgttattatagggtacagaactgacaaaacagccctcatactggggctttac
gatgaggagaataatttaataaacataggaagttgtgaatcaggcctatcccagaaggaa
ttaaaagcattctatgaagttgccaaggggataaaagccccagataattattataacttt
aaagaaaaaaatgtgcagtggttaaaacctctgctaacatgtaaagtgagatttatggaa
tggtctgaaaacatgaaaatgagagcaccttcttttattcaatttgagtataacgtaaaa
ccagaagagtgcaggtttgaataa

DBGET integrated database retrieval system