KEGG   Thermovirga lienii: Tlie_0755Help
Entry
Tlie_0755         CDS       T01644                                 

Definition
(RefSeq) pyruvate kinase
  KO
K00873  
pyruvate kinase [EC:2.7.1.40]
Organism
tli  Thermovirga lienii
Pathway
Glycolysis / Gluconeogenesis
Purine metabolism
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:tli00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Tlie_0755
   01230 Biosynthesis of amino acids
    Tlie_0755
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tlie_0755
   00620 Pyruvate metabolism
    Tlie_0755
  Nucleotide metabolism
   00230 Purine metabolism
    Tlie_0755
Enzymes [BR:tli01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     Tlie_0755
Exosome [BR:tli04147]
 Exosomal proteins
  Proteins found in most exosomes
   Tlie_0755
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
789894..791702
Genome map
AA seq 602 aa AA seqDB search
MKKRVKIVCTLGPSCSKYDVLRNMVQAGMNVARLNFSHGDYESHGRLLDNARRAEKDLGM
PIPIMIDTKGPEIRTGTLAGHVPVVLKGGDFLVITTRPTEGNKEKIYVDYPGFVREVAPG
RTIFIDDGRISLKVEKILSEEETLCKVVVGGELGENKGVSVPGALNNLPILTKKDINDIK
WAISRGADYLALSFVRTREDVLKARKLLEDLDGDLQIISKIETMQAVRNLEEIIEVSDGV
MVARGDLGVEIPLEEVPMQQKRIIDLCRFVGKPVIVATQMLDSMIRNPRATRAECSDVAN
AVLDGADALMLSGETAQGKYPVEAVQTMAKIIERTEKDPLFWSITSNKGYENIKRISDAV
GNAAVMIAKRMDAHGILCMTQSGSTAQIISKYRPKSKIIGATPSEKIYRKLGLVWGVHPL
KVSKEENLENAITAGIERALEEGMLNEGDLVVVTAGVPVGISGTTNIIEVVSVGQILLKG
MSIMKKVACGKVVTALDGAEAAMKISYGDILVCRQTDKGFVEAAKKASAIIAEEGGLTSH
AAILSLELRIPCIVSAKSAMTVLEDGMIVTVDGNRGIVYRGRVHLESKGNKSDESGENVA
GR
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagagagttaagatagtttgtacccttggtccatcttgctcaaaatatgatgtt
ttaaggaatatggttcaggcgggcatgaacgttgcccgcctgaattttagccatggtgac
tacgaaagccatggtaggcttttggataacgcaagaagggcagaaaaagacttggggatg
cccattcctatcatgatagacactaagggaccagaaataaggactggaacattggccgga
cacgtacctgtagttttgaaaggcggtgattttctagtaatcaccacaagaccgaccgag
gggaacaaggaaaaaatctacgtggactatccaggttttgtaagagaagtcgctcccgga
agaactatttttattgacgatggaaggatcagcctcaaagtggagaaaatattatctgaa
gaagaaaccttatgcaaggtcgtggttggtggagagttgggcgagaataagggggtttcg
gttccgggagctttgaacaacttgcctattcttacgaagaaagacatcaatgacataaag
tgggctatttcaaggggagcagactaccttgccctttctttcgtccgaactagggaagac
gtcttgaaggcgcgaaagctcttagaggaccttgatggtgatctccagatcatatctaag
atagagacaatgcaggctgtgaggaacctggaagaaattatagaggtctctgatggagta
atggttgcccgtggagatttgggagtcgagatccccttggaggaagttccaatgcagcag
aaaaggatcatagatttatgtagatttgttgggaaacctgtaattgtggctacccagatg
ctggattccatgataagaaatcccagggcaaccagggctgagtgcagtgatgtggctaac
gctgtgcttgacggagcagatgcccttatgctttcaggtgagacagcgcaaggtaaatat
cctgtagaagcagttcaaacgatggctaaaataatagagagaacggaaaaggatcccctc
ttttggtccattacttccaacaagggctatgaaaatataaagcgcatatctgacgctgta
ggaaacgcagcagtgatgatagcaaagagaatggatgcccatggtattttgtgcatgacc
caaagtggaagtactgcccagataatcagtaagtacaggcctaaatctaaaataataggt
gctaccccttctgaaaagatttacagaaagctggggcttgtatggggagtgcaccccctt
aaggtcagcaaggaagagaacctggaaaatgctataactgcagggatcgaaagggccttg
gaagaaggaatgttgaatgagggagacttggtagtggttactgcaggagtgccggttggc
atatctggtaccaccaatatcattgaggtggtttctgtgggacagatattactaaagggt
atgtcgataatgaagaaagtggcctgcgggaaggtggttacggcacttgatggggcagag
gctgcaatgaagatttcctatggagacatattggtatgtaggcaaaccgataaggggttc
gtcgaagcggccaagaaagcgtctgcaataatagcggaagagggagggcttaccagccat
gcagccattttatcactggagctgaggattccttgtattgtgagtgccaaatcagccatg
acggtcctggaggatggtatgatagttacagttgatggtaatagagggatagtatatagg
ggtagggtccatttggaatcgaaaggcaataaatcggatgaatcaggggagaatgttgct
ggaagataa

DBGET integrated database retrieval system