KEGG   Thermovirga lienii: Tlie_0755Help
Entry
Tlie_0755         CDS       T01644                                 

Definition
pyruvate kinase
Orthology
K00873  
pyruvate kinase [EC:2.7.1.40]
Organism
tli  Thermovirga lienii
Pathway
Glycolysis / Gluconeogenesis
Purine metabolism
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:tli00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Tlie_0755
   01230 Biosynthesis of amino acids
    Tlie_0755
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tlie_0755
   00620 Pyruvate metabolism
    Tlie_0755
  Nucleotide metabolism
   00230 Purine metabolism
    Tlie_0755
Enzymes [BR:tli01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     Tlie_0755
Exosome [BR:tli04147]
 Exosomal proteins
  Proteins found in most exosomes
   Tlie_0755
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
789894..791702
Genome map
AA seq 602 aa AA seqDB search
MKKRVKIVCTLGPSCSKYDVLRNMVQAGMNVARLNFSHGDYESHGRLLDNARRAEKDLGM
PIPIMIDTKGPEIRTGTLAGHVPVVLKGGDFLVITTRPTEGNKEKIYVDYPGFVREVAPG
RTIFIDDGRISLKVEKILSEEETLCKVVVGGELGENKGVSVPGALNNLPILTKKDINDIK
WAISRGADYLALSFVRTREDVLKARKLLEDLDGDLQIISKIETMQAVRNLEEIIEVSDGV
MVARGDLGVEIPLEEVPMQQKRIIDLCRFVGKPVIVATQMLDSMIRNPRATRAECSDVAN
AVLDGADALMLSGETAQGKYPVEAVQTMAKIIERTEKDPLFWSITSNKGYENIKRISDAV
GNAAVMIAKRMDAHGILCMTQSGSTAQIISKYRPKSKIIGATPSEKIYRKLGLVWGVHPL
KVSKEENLENAITAGIERALEEGMLNEGDLVVVTAGVPVGISGTTNIIEVVSVGQILLKG
MSIMKKVACGKVVTALDGAEAAMKISYGDILVCRQTDKGFVEAAKKASAIIAEEGGLTSH
AAILSLELRIPCIVSAKSAMTVLEDGMIVTVDGNRGIVYRGRVHLESKGNKSDESGENVA
GR
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagagagttaagatagtttgtacccttggtccatcttgctcaaaatatgatgtt
ttaaggaatatggttcaggcgggcatgaacgttgcccgcctgaattttagccatggtgac
tacgaaagccatggtaggcttttggataacgcaagaagggcagaaaaagacttggggatg
cccattcctatcatgatagacactaagggaccagaaataaggactggaacattggccgga
cacgtacctgtagttttgaaaggcggtgattttctagtaatcaccacaagaccgaccgag
gggaacaaggaaaaaatctacgtggactatccaggttttgtaagagaagtcgctcccgga
agaactatttttattgacgatggaaggatcagcctcaaagtggagaaaatattatctgaa
gaagaaaccttatgcaaggtcgtggttggtggagagttgggcgagaataagggggtttcg
gttccgggagctttgaacaacttgcctattcttacgaagaaagacatcaatgacataaag
tgggctatttcaaggggagcagactaccttgccctttctttcgtccgaactagggaagac
gtcttgaaggcgcgaaagctcttagaggaccttgatggtgatctccagatcatatctaag
atagagacaatgcaggctgtgaggaacctggaagaaattatagaggtctctgatggagta
atggttgcccgtggagatttgggagtcgagatccccttggaggaagttccaatgcagcag
aaaaggatcatagatttatgtagatttgttgggaaacctgtaattgtggctacccagatg
ctggattccatgataagaaatcccagggcaaccagggctgagtgcagtgatgtggctaac
gctgtgcttgacggagcagatgcccttatgctttcaggtgagacagcgcaaggtaaatat
cctgtagaagcagttcaaacgatggctaaaataatagagagaacggaaaaggatcccctc
ttttggtccattacttccaacaagggctatgaaaatataaagcgcatatctgacgctgta
ggaaacgcagcagtgatgatagcaaagagaatggatgcccatggtattttgtgcatgacc
caaagtggaagtactgcccagataatcagtaagtacaggcctaaatctaaaataataggt
gctaccccttctgaaaagatttacagaaagctggggcttgtatggggagtgcaccccctt
aaggtcagcaaggaagagaacctggaaaatgctataactgcagggatcgaaagggccttg
gaagaaggaatgttgaatgagggagacttggtagtggttactgcaggagtgccggttggc
atatctggtaccaccaatatcattgaggtggtttctgtgggacagatattactaaagggt
atgtcgataatgaagaaagtggcctgcgggaaggtggttacggcacttgatggggcagag
gctgcaatgaagatttcctatggagacatattggtatgtaggcaaaccgataaggggttc
gtcgaagcggccaagaaagcgtctgcaataatagcggaagagggagggcttaccagccat
gcagccattttatcactggagctgaggattccttgtattgtgagtgccaaatcagccatg
acggtcctggaggatggtatgatagttacagttgatggtaatagagggatagtatatagg
ggtagggtccatttggaatcgaaaggcaataaatcggatgaatcaggggagaatgttgct
ggaagataa

DBGET integrated database retrieval system